SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014622 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014622
Domain Number 1 Region: 11-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-78
Family BAR domain 0.00000000764
Further Details:      
 
Domain Number 2 Region: 286-348
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-23
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014622   Gene: ENSONIG00000011610   Transcript: ENSONIT00000014633
Sequence length 351
Comment pep:novel scaffold:Orenil1.0:GL831343.1:121033:165077:1 gene:ENSONIG00000011610 transcript:ENSONIT00000014633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMEKKVDVTSRAVLDIMTKTTEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAETVLGDAMLKFGRELGEESSFGLALMDAGEA
MKELGEVKDALDMEVKQNFIDPLQNLHDKDLKEIQHHLKKMEGRRLDFDYKKKRQGKVQD
DEIKQALEKFDESKEIAEQSMFNLLESDIEQVSQLSALVQAQLEYHSRASEILQQLSRKM
EDRIKEVSSKPRKEYTPKPRMTLELLPPSESHNGGIHSAKSPGRSPAPMDQPCCRALYDF
EPENEGELGFKEGDVITLTNQIDDNWYEGMINGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences I3K0H7
XP_005461243.1.78416 ENSONIP00000014622 ENSONIP00000014622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]