SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014659 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014659
Domain Number 1 Region: 241-509
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-67
Family Protein kinases, catalytic subunit 0.0000000267
Further Details:      
 
Domain Number 2 Region: 108-233
Classification Level Classification E-value
Superfamily SH2 domain 1.85e-32
Family SH2 domain 0.0000543
Further Details:      
 
Domain Number 3 Region: 67-126
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000484
Family SH3-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014659   Gene: ENSONIG00000011645   Transcript: ENSONIT00000014671
Sequence length 516
Comment pep:novel scaffold:Orenil1.0:GL831343.1:301792:317631:1 gene:ENSONIG00000011645 transcript:ENSONIT00000014671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHSNHSIRSIICCCCAVQTREFSTRVELESRTSLCFPNRRYSGQPTRLQVERSRRKLPL
PPPEGEDGEGEGLLSVVAMYDFTAKEDTDLTLKQGEEYIILHKQDQLWWRAQDKHGNKGF
IPSNYVTEKNKIEANAWYCKNITRTEAEQLLRQEDKEGGFVVRESSRKGVYTVSVYTKTI
SSSSGDVRHYQIKITDTGQYYLAEKHIFSSIPEVIHYHEHNAAGLVARLRYPVGPMGRCV
PATAGFSSEKWEINPSELTFMKELGSGQFGVVRFGKWRGQQRVAIKAIREGAMYEEDFIE
EAKVMMRLCHPKLVQLYGVCLQQRPLLIVAEFMENGCLLNFLRQRGKALLESWLLSMCQD
VCEGMDYLEAHSFIHRDLIQAARNCLVNEHNVVKVSDFGMTRYVLDNQYTSSNGAKFPVK
WSPPEVLHYSKYSSKSDIWSFVLNRLQIFSEGRTPFENRSNVEVVTDITRGIRLYRPQRA
SQPLYAIMYRCWHEKADGRPSFSELLEEIRKLAENQ
Download sequence
Identical sequences I3K0L4
ENSONIP00000014659 ENSONIP00000014659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]