SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014758 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014758
Domain Number 1 Region: 375-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.44e-39
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 35-102
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-19
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 161-227
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014758   Gene: ENSONIG00000011718   Transcript: ENSONIT00000014770
Sequence length 538
Comment pep:novel scaffold:Orenil1.0:GL831167.1:3616765:3619863:1 gene:ENSONIG00000011718 transcript:ENSONIT00000014770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIRSQSTSTNLRVLWLCFMNVCVCIMASASSLLCEEQFLCSICLNTFTDPVTTPCGHNYC
KTCITEYWDSSDVTQCPLCKKRFRRRPQLQVNTEFRDMMECFSSMRVKDGEVLAKPGEVS
CDVCIGPKRKAHKTCLVCLTSYCQADLEPHQRVASLKKHKLIDPVSNLKDRVCQKHDKML
ELFCCTDQVCICFMCLKDDHVTHVTIPSERAFREGKARLESLTSEMKEMEKTKSSHVKEA
KRLAQQNKDESERELADIAEVLEALVASLLKNQDELIKLIQEKHKAVETQAETYIALLEE
EVVELGRGIAELEEYLQTEDHLHFLHSCSTLHYVAFNKDVLKPLSHGEPPFTDSLSKMSQ
QIYLGMVKKYSAQIEKMQCNSMNLTFDPHVAHPILKVYEGGRKLTLDLHLRPYSPLFDRP
FLKQPYVLATEGFSSGRFYYEVCVSKSKVWTLGVVKESVNKHMGFPPTPEDGAWTLSARY
TGWDVQYFACDSKILFSHVRQIPQTVGVFVDYEKGEVSFYDVDARTLIYSFTGCAFTE
Download sequence
Identical sequences I3K0W3
ENSONIP00000014758 ENSONIP00000014758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]