SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015060 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015060
Domain Number 1 Region: 153-350
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-57
Family Prokaryotic proteases 0.00000107
Further Details:      
 
Domain Number 2 Region: 365-461
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-18
Family HtrA-like serine proteases 0.0013
Further Details:      
 
Domain Number 3 Region: 25-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000011
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 4 Region: 94-140
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000036
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015060   Gene: ENSONIG00000011960   Transcript: ENSONIT00000015073
Sequence length 463
Comment pep:novel scaffold:Orenil1.0:GL831480.1:460512:477472:-1 gene:ENSONIG00000011960 transcript:ENSONIT00000015073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLAYLTLVFSAVHAGLLRERQTCPQVCAASQCPAPPHACYYGQVKDICGCCVVCAAGE
GEACGKRSSGHLSCGNGLRCDSGPGKAGGFHSLCVCASSGPVCGSDGRTYPSICRLRAEN
RRAELGETSPVFLIQRGRCDSGAQHPGSIRYKFNFIADVVDKIVPAVVHLELFQRVPFSS
EDVSVSSGSGFIVSEDGWIVTNAHVLANKQRIKVELKSGVHYDAAVRDVDQKMDIALIKI
DPDGPLPVLRLSQSSDLRPGEFVVAVGSPFSLQNTVTTGIVSTANRNSLELGFKDSDMDY
IQTDAIINYGNSGGPLVNLDGDVIGINTLKVAAGISFAIPVDRIRQFLADSYNRQASGNS
LPKKKFIGVRMVQLTPSLIRDLKEREPEFPDVSSGVYIYEVIPGTAASRGGMSDHDVIIG
INGQPVHTTQEVSDAIRHSTSLFVLVRRKDGDVTLMIIPEETD
Download sequence
Identical sequences I3K1R5
XP_003459047.1.78416 ENSONIP00000015060 ENSONIP00000015060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]