SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015114 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015114
Domain Number 1 Region: 344-538
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 77-178
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000159
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 190-265
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000176
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015114   Gene: ENSONIG00000012007   Transcript: ENSONIT00000015127
Sequence length 1117
Comment pep:novel scaffold:Orenil1.0:GL831144.1:1770621:1797326:-1 gene:ENSONIG00000012007 transcript:ENSONIT00000015127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNMSPQQQQDSLSRGGALQEHKRRTKSQSYRRQSAPSLVITKALTRSKTLSRESFLVPI
CPETCPLIQSFLTGSDRSFLLQGHAQLKTGMQTQDRHLFLFTDILVIAKAKSANHFKQKA
QVRVCEMWTAGCMDEVCEGSTNPERSFVMGWPTCNCVATFSSAEQKEKWLALLKSRIKEE
KEIEEPKTIPVRVYGKGINTFALTKTIPVSNSDSTNEVIRLALQQFGIIGNVKDFQLWVL
SKRDNAPYPLIGHEFPFSIHMSHVRYSQGGGRDAAAPPADRLKAEQLQVYKQFQFILKPR
PVEPPQQHADFSGKPFKRRRSLIAWAFWRGSSSNLNELSLSTARGCLFGQPLSSVCAGDT
LPKPVMDMLTFLYHEGSWTRGIFRRPAGARAVRELRDALDAGESQLPLARDHIFIIAGVF
KDFLRSIPGSLLSCELHEDWMEVLEEEEEEEEQVQDVQRMICRLPKENALLLRYLLAVLH
GIQGNAQENQMTTFNLSVCIAPSMLWPPGVPCSPEVEGEGTKKVCELVKFMIEHCQEILR
EHPSSLFGGPPQRLNSEEMGTESWIYPLTDSSYDSLENELDNSSGGSPGLCNRRCLQPKP
LQGSLDSILTFSDYDQDTAPETRLNPLGRHRRQELDLSSPRQDAPIVDTSSTLESLSLEG
RHMQRRRSEPAIAYVAKFRPCASASTDGVTGEDEDGEEELSKEPSNHTVTRMHSRVQNRR
YGGESGLEASSSSLSSTPTSPAPTRSSPDSLDSLSGDQTWATRRGLYPKKTYLPSNSSSG
SLSTAVTSTPLTISSVLASSEHAEQEICPKNSPPKEPVSWGTLMGCRGLHPNSWLKKDRR
LSLTQQDNLEKQEEDKTAGRPDKSLTPGKPEKGKAGEKGAANLISGSQTKPRTSCRPPKD
AGGAGGSHVKGKAGLLKQDSSSPPSHYHSTGNLQFPKSAWFHSPETPITLRQKTPWSDTS
AQKCAAQSDATELKQPSPSVFYKQGGPSLSLFKRPKSQSTEQDHNARLYQRRGSEPGRQV
VDRAATFTRARLPSDPGLKVSGVDSQGGTSEARYCLSPCATKAVRDYFSSHPQSNPQSSH
QVALALVESRREWVKRCSDPTAEPDFDQLLFAEESYV
Download sequence
Identical sequences I3K1W9
ENSONIP00000015114 XP_003440957.2.78416 ENSONIP00000015114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]