SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015276 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015276
Domain Number 1 Region: 319-579
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-56
Family Nuclear receptor ligand-binding domain 0.00000000428
Further Details:      
 
Domain Number 2 Region: 246-324
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-27
Family Nuclear receptor 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015276   Gene: ENSONIG00000012131   Transcript: ENSONIT00000015289
Sequence length 581
Comment pep:novel scaffold:Orenil1.0:GL831181.1:195121:201428:1 gene:ENSONIG00000012131 transcript:ENSONIT00000015289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQTQCGSSPQGASPASQSSGGERSCDFLTPEFVKFSMDLTNSEVSAAASGPTFGPLA
DSYGSGYDVKPPCLFQMQVQGELPCVKVEDAHGCPRYQPNQHPAHQSDELLSSPSPVYYY
RSPSPHSSLTPNFQLPSGHIWEDSGSLYSFRQDYLAAHRKNALSRFSLLSLKHAQHDGQS
LSTCQVKFDGALAHQQLETPTVLGSTGLGKQSGVGFAHPLQLAHGHHFMEYQTSSAPGRG
PLSSEGVCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLAAKSCPVDKRRRNRC
QYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPRALPDASSPGSTLLSALIRAHVESNP
PPSRLDYSKFKENPGSPPGDDAQHVRQFYDLLTRSMEVIRGWAQKIPGFTSLPKHDQDLL
FYSAFLELFVLRLSYRSNPEEGKLIFCDGSVWHRLQCLRGFGEWIDSIVEFSANLQRMNL
DVSTFSCICTLALVTERHGLKEPKKVEELQSSVVRCLKDGGTSVDGGSSCWSNHLSRLLE
KLPELRTLCIQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences I3K2D1
XP_003446577.1.78416 XP_005452334.1.78416 ENSONIP00000015276 ENSONIP00000015276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]