SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015850 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015850
Domain Number 1 Region: 382-473
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.49e-37
Family Small-conductance potassium channel 0.00000611
Further Details:      
 
Domain Number 2 Region: 251-422
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-25
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015850   Gene: ENSONIG00000012591   Transcript: ENSONIT00000015865
Sequence length 565
Comment pep:novel scaffold:Orenil1.0:GL831204.1:2204327:2216102:-1 gene:ENSONIG00000012591 transcript:ENSONIT00000015865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKTRQRQSQTVSQGSKVYLPKHTPPPLEALQSSGILNGDAVRPLSSHGTLRSSFSDLP
SGQQPIQLLHSAILEDAFSKVIREDSSKANGEEGSTPPKKTKDISYRLGQRRALFGKRKQ
LSDYALVCGMFGIIVMVIETELSRGFYTKESMYSYVLKGLISLSTAILLGLIVMYHAREI
QLFMVDNGADDWRIAMTFERLVFIVLELLICAIHPIPGKYVFTWTTRLAFSYAASVTYAD
IDIILSVPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFDTRFVMKTLMTICPGTV
LLVFSVSCWIIAAWTVRVCERYHDAQEVTSTFLGAMWLISITFLSIGYGDMVPHTYCGKG
VCLLTGIMGAGCTALVVAVVARKSELTRAEKHVHNFMMDTQIYKKIKNTAANVLRETWLI
YKNTKLVNKIDHARVRHHQRKFLQAIHQLRRVKMEQRKLTDQANTVADLAKTQNMMYDLV
SELQHRSGELDTRIVALEEKLDSILQCVQSLPVVLSQAIAKLQKDFLDDLACRVHFLSSS
LSSECCSVPARQLCPGSTAPETPYN
Download sequence
Identical sequences I3K405
ENSONIP00000015850 ENSONIP00000015850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]