SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015926 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015926
Domain Number 1 Region: 14-87
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.32e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015926   Gene: ENSONIG00000012655   Transcript: ENSONIT00000015941
Sequence length 574
Comment pep:novel scaffold:Orenil1.0:GL831204.1:2503195:2509269:1 gene:ENSONIG00000012655 transcript:ENSONIT00000015941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAATATPQVMRDRLLQAIDGQSNICNMVVVVEVISFLEKYPITKEALEETRLGKLINDV
RKKTKNEDLAKRAKKLLRNWQKLIEPGKVEVLSKGGTGTSWSSIGGAHPCISAPAANPPS
GKTGPELKNRNDFNNCSLRVEKLSNRKRKGEQKEGPILPAKIPKMTLNDKIQNSKQLQTN
GIGAGAEIFADIRAHQSLDRDIPEALDNDKLNKIPVHAVKPHSNFPGCSKPPSTSSLLKA
SVLQQQARQEPAASGGKCRPRSPRCSLHSPQTLKQEAVVKQTAPQAQSIPGPSVRPGTVD
NSGLGLPPQAFSASVQGFHTDGSGSADLDSHRLPPSMSLHGSTATPCSGVESLEDEGPSF
NTGKRKRQKYRPKDYSVNLEGQTVEDRTKPVRLKDRRLTFDPVTGQIKTSFQKDSFPEGE
VRPNNKPENNWSEQPKQNPPVPPSPFQQTDWKELSRSEIIQSYLSQQSNVLTSSGAHTPG
AHFFMSEFLKKEEHQSKDAKKTHTLVSDSPPREIPGVSREVNGKDLSRLHTQHWSGVNGC
YDTMGKWYDWTECISLDPHGDESRLNILPYVCLD
Download sequence
Identical sequences I3K481
ENSONIP00000015926 ENSONIP00000015926 XP_003449116.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]