SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015990 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015990
Domain Number 1 Region: 360-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-32
Family SPRY domain 0.0074
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-20
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.82e-16
Family B-box zinc-binding domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015990   Gene: ENSONIG00000012704   Transcript: ENSONIT00000016005
Sequence length 527
Comment pep:novel scaffold:Orenil1.0:GL831141.1:2470182:2476134:-1 gene:ENSONIG00000012704 transcript:ENSONIT00000016005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQENQVNRDKLCCSICLDLLKDPVTIPCGHSYCMNCVKSYWDEEDQKETHSCPQCRQT
FTPRPALVRNTVIADLVEETKKTGLQGAKADLCHAEHEDVSCDFCTETKLKAVKSCLQCL
VSYCEQHLQPHYEVAALKKHKLVDPSQKLQEIICSRHNEVMKIFCRTDQQCICYLCSMDE
HKGHDTVSTAAEMIEKQRELKESQDKIQQRVQYSEKHLKMLEQEVETFNQSADKAVRDSE
EIFTEVKQRIRARQKSEVSHVYELKQEISELRRRNTEMEQLHTEDPTQFLHNYALLSHLS
EATDSASINIHPERYTEDVTAAVSETREILQDILSEEWTKASLRGTEWDVLLSQTEPTTR
DEFLNYKCQNTCNLNTAHQRIECVQGLVENTSTYQDHPDRFTVLCRESLTGCCYWEVDWN
GNVFIALAHKHISRSGRESVSGNNDRSWALECFCGGYEFRHNTIRTPVSGPQSSRIGVYL
DRSAGILSFITTETMTHLHRVQNRFSWLLCPGFGIYNLKASAKILDD
Download sequence
Identical sequences I3K4E5
ENSONIP00000015990 ENSONIP00000015990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]