SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016039 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016039
Domain Number 1 Region: 440-700
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-52
Family YWTD domain 0.0000000622
Further Details:      
 
Domain Number 2 Region: 232-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000157
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 3 Region: 29-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000471
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 4 Region: 146-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000589
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 5 Region: 270-310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 6 Region: 105-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 7 Region: 186-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 8 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 9 Region: 394-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000324
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 10 Region: 315-351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.00038
Further Details:      
 
Domain Number 11 Region: 358-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000435
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 12 Region: 703-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000241
Family EGF-type module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016039   Gene: ENSONIG00000012744   Transcript: ENSONIT00000016054
Sequence length 865
Comment pep:novel scaffold:Orenil1.0:GL831141.1:3194804:3244601:-1 gene:ENSONIG00000012744 transcript:ENSONIT00000016054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDYNKLSLLFCLGVFFLKCCVSSSVGTKTECEANQFQCGNGRCIPSVWQCDGDEDCSDGS
DENSCVKKTCAEVDFVCDNGQCVPKRWHCDGEPDCEDGSDESLDICHMRTCRMNEFSCGA
GSTQCIPVFWKCDGEKDCDNGEDEVNCGNITCAPNEFTCASGRCISRNFVCNGEDDCGDG
SDEVECAPSSCGPSEFQCGNSSCIPASWVCDDDVDCQDQSDESPSHCGRHPTPPAKCSPS
EMQCRSGECIHKKWRCDGDSDCKDGSDEANCPVRTCGSDQFKCDDGNCILGSRQCNGLRD
CADGSDEANCRNMTQCNGPEKFKCRSGECIEMSKVCNKVRDCPDWSDEPIKECNFNECLL
NNGGCSHICKDMVIGYECDCTPGLQLIDHKTCGDIDECMNPGICSQICINLKGGYKCECH
NGYQMDPTTGVCKAVGKEPCLIFTNRRDIRRLGLERKEYTQIVEQQRNAVALDADFDQQT
IFWADLGQKAIYSTLLDKRVDVGTHKKVIDNVQTPVGIAVDWIYKNLYWSDLGTKTISVA
SFNGTKQKVLFNRGLKEPADIAVDPLSGFLYWSDWGEPAKIEKSGMNGVDRQVLVATDIQ
WPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRNKVLQSSEYLAHPFALTVFEDRVFWT
DGEKEAIYGANKFTGSDVVTLASNLNDPQDIIVYHELIQLSGTNWCLEKGENGGCSYMCL
PAPQINKHSPKYTCVCPEGQELTADGLRCRPDPTFKGPSKDAGKALIQPPPEANVSTSIQ
VNSTARGSAAAWAILPVLLLAMAAAGGYLMWRNWQLKNQKSMNFDNPVYLKTTEEDLNID
ITRHGANVGHTYPAISIVSTEDDLS
Download sequence
Identical sequences I3K4J4
ENSONIP00000016039 ENSONIP00000016039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]