SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016217 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016217
Domain Number 1 Region: 78-259
Classification Level Classification E-value
Superfamily vWA-like 9.69e-42
Family Integrin A (or I) domain 0.00055
Further Details:      
 
Domain Number 2 Region: 1435-1632
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-34
Family Pentraxin (pentaxin) 0.00059
Further Details:      
 
Domain Number 3 Region: 2754-2820
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-19
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 1970-2038
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.91e-18
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 2211-2282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 6 Region: 2153-2222
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 2872-2933
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.78e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 2697-2765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.1e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 1796-1859
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.25e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 3224-3295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.00066
Further Details:      
 
Domain Number 11 Region: 2506-2575
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 12 Region: 2272-2338
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.21e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1912-1973
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000256
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 14 Region: 1691-1754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 15 Region: 2564-2632
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000418
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2928-2993
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000621
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 2388-2459
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 18 Region: 3404-3461
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2448-2517
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000751
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 1855-1916
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000103
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 3285-3346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000108
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 22 Region: 1637-1708
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000126
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 23 Region: 2812-2881
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000131
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 24 Region: 437-504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000834
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 25 Region: 3102-3167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000139
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 26 Region: 376-447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 27 Region: 1315-1357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000107
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 28 Region: 3048-3109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000114
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 29 Region: 1391-1432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000115
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 30 Region: 2330-2399
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000195
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 31 Region: 2980-3041
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000222
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 2655-2707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 33 Region: 1201-1320
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000738
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 34 Region: 1353-1396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000837
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 35 Region: 3360-3413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000103
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 36 Region: 2027-2095
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000027
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 37 Region: 2092-2158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000612
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 38 Region: 995-1140
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000903
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 39 Region: 3173-3230
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000876
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 40 Region: 491-552
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000264
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 41 Region: 1749-1793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000797
Family EGF-type module 0.036
Further Details:      
 
Domain Number 42 Region: 725-777
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000111
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016217
Domain Number - Region: 3495-3524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000539
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 3523-3553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 3455-3491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016217   Gene: ENSONIG00000012886   Transcript: ENSONIT00000016232
Sequence length 3562
Comment pep:novel scaffold:Orenil1.0:GL831189.1:1576525:1710388:1 gene:ENSONIG00000012886 transcript:ENSONIT00000016232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWTTCLLLLCVLDAWTTAWPAVQQSQRQQQQPRRYRQMSTLSSSSSSSSPGNLSESAESK
VERLGMAFKRNVRELREKSSCLDLVFLVDESSSVGANNFLSELRFIRKMLSDFPVAPENT
RVALVTFSSKTHVVTRVDHISAPKSHQHKCSLFNQEIPAINYRGGGTYTKGAFQRAAQIL
RHSRGNATKVIFLITDGYSNGGDPRPVAAALRERGVEIFTLGIWQGNIRELHDMASQPKD
QHCYLVHNFAEFEALARRALHEDLPTGSYIQEDLSRCASLCEAGKDCCDLMASCKCGTHT
GQYDCICEKGYYGKGLQHECTACPPGTYKPEGTPGGVSTCLPCPDAQHTSQPGSTSPNDC
VCKPGYTPIGMTCQVIHCPALLPPEYGFFVQNVCNNHFDAACGVRCQPGFDLQGTGIRLC
QADGTWSGTPASCRVRSCPHLSLPQHGFLSCSSSFASYRVECQVGCDRGYRLEGDSKLTC
QANYQWSGPQPRCVEVRCPPIVTLKNIFLSPPACGRRAVSPGFVCLLNCRPGYSLQGNRK
AVCLSSGNWTANVYKAVCTDTEPPWLQCPDNIVAGTVERRGTAIVSWNVPNATDNSKEEV
VVQAKPVYSPPQLFPIGKETITYFATDRSGNQANCSFTVTVIDTEPPVIDRCRSPPAIQA
TNTETAVDWEVPQFSDNSGGRLTVTSSHRPGSLFPVGETLVQYTATDAAGNSRTCNLTVT
VQGTTCDQPYVPVNGEFICSEEEEGVNCTLHCKDGYSLTQDAVHSYFCAYNGIWEPAYSP
DRPDCSLNRIANNGFKPFEMLFKASRCDDVDLVKSFTGEFNSKLGGMLPKICGNDDVTCK
LEVMSQGHCLEYNYDYENGFAIVPGGWGDNWGTQGSQDYAYFESGFATSTRQLPTQNQDD
SMQLHHRTKRHRKIKGPTKDHKIQIYFNITASIPLPLSRNDSIEVANQKRLLRMLEQLTN
RLKRTLSKQPLSNYHLSSEMIIADPKSLESKRASLFCRPGSVLKGRMCVQCPVGTYFSLE
YNECESCWLGSYQDQEGQLECKSCPEGTSTAYLHSRSITECKGQCKPGSHSRNGLEICES
CPLGHFQPSFGARKCEVCPDETSTVTRGAVDETECGVPCSAGHFSRTGLVPCYPCPRDYY
QPEHGRSYCLSCPFYGTTTITGATTIQHCSSFGSSFLPKEESVTAAPEVEVIDEYQSSSQ
VFHECFLHPCQNKGTCEEVGAGYVCTCMPGFTGAKCEIDIDECNSAPCQNGGLCKDGMGD
FQCQCKPGFLGSLCEAEVNECHSNPCLNEGVCVDEVNKFACSCSTGFTGSRCELEIDECL
SNPCLNGGVCEDMTGGYTCNCAVGFSGDSCEIDTDECYSAPCLNGGSCLDAVNSFRCQCV
EGYRGRLCEVDVDECDPNPCVNGASCLDGLGSYTCRCLPGFNGTRCETEMSSAFNLDFEV
SGIHGYVMMDGVMPALTEITCTFWMRSSDTTNYGTPVSYAVEGSDNAFLLIDYNGWVLYV
NGKERITDCPAVNTGQWYHIGVSWRSWDGDWRIYINGKPSDGGKGLSVGTTIPAGGALVL
GQDQDQRGEGFNPVESFVGSLSQLNIWDRVLTPQQIKVLASSCPASHVTHRGNVLAWPDF
LSGVVGRVKVNLNSIFCADCPKLENTVPHLHVSTVDVRPGAQVQLSCDPGFYLVGEPVLQ
CQNRGEWSHNLPSCERVSCGPPHLLENGFFQGTDFHAGSSVVYECNAGFYLLGDTKVHCT
NSGKWGGTSPACLDVDECALGSDCDDHASCQNTEGSYACTCIHPYTGDGKNCTEPVKCEN
PGTPDFGRRYGSNFLMGSEVVFSCDNGYELIGSSQLQCLETGDWDDAVPYCRALSCPAPS
VPENSIMTGNNFTYGSKVTFSCKKGFQPQVPYEFQCLSSLRWTGTPPTCHPVTCGGPPTV
ENADYTLNTNTYLSTVTYTCNEGYRPQGSMEVICEATGEWSRPFPRCVRVLCSEPPLLEN
AVTVGENFELGNKVHYVCKEGYTLIGPETRECQSSGQWSESTAQCVPRSCGPPPAIDHAE
PYETHKLFGDTANYYCTDGYIAGNNSKMVCNAQGMWVPPDGMEAPRCIANFCLRPPELPH
AILDSVNKPKYASNSEVSYKCEEGFMLNTTATLRCLMGGEWEPSPYDIGCVPVRCSKPES
IDQGYVIGTNYSFGAVVAYSCFKGFLIRGEKRRTCNGNGEWGGALPTCVPVSCSHPPSLK
NGYFQVKGRLTYNSKVTYACNAGYRLIGRPERVCQANRQWSNQDPPTCVLLTCDPPPNIV
HGHYKGSDFQVGRKVVYVCDEGYELVGDATWTCLKFGRWDKTRPPRCSPVQCPEPPLEEN
HLVLRGLDSESGTVELSCEDGYVLEGARFLRCTPSQEWNDTFPVCKQVFCDPPPSVPFGG
PSRSSRLLPFSSVVTYTCIGGFTLRKEGSVSCLANGQWSSPYPECIPVECPQPVEISDGI
VDVQGLMYLSKALYSCKTGYNLVGNSTILCGEKGLWIGGVPSCRPIECSIPKQITNGKVV
YTKLQFDHSATYSCNRGYRLQGTETARCLASGEWDIEPPACVQISCTPPQPVENGFVEGQ
DHSYGVTIFYSCFPGFQLVGQDHLTCEEFGWSSSVPVCVPSDCGLPPHIDFGEYVRVTEL
GGRFTSKDTGRLDLNFLHGTLIEYRCHRGYDLTSQVRLVCQEDGGWNGTAPSCVPAECQI
PPGPEHGWMNVTHASLGTTLTYTCDEGYELKGEPVRQCVSGRVWTTDAPVCQPVSCGDPG
AVDNGTTQGGDFVYPEVLHFQCNPGFVLKGSSTITCQADGKWTGLKPQCEPVSCGPPKIP
GDITFKGTEFTYNNKIELSCQPGFILKGRSPSICQADGTWSHKAVACVSARCEKPSPILN
GRMLGSEFGYSSKIKYECDEGYTLNGDSTRVCQSDGLWDKPAPRCDIISCDPPEDISHGY
VNGSSFNYDDIVEYVCFDGYEVVGDPILRCSSQGLWVGPVPQCQPCICTLPVVKYGVVLG
HDRACGDRVHFQCNDGYKLLGPSQAVCEKGGVWSPGVPVCSRGRCTAAPPTVPNAVLQGG
SASYPEMAIYRCRPGYQLKGYAYLTCGRDGRWGEPRIRCEPVSCGKPPEVANARVVGDIF
SFPNQITYRCDDGYELATQTASLSCQSDATWSKHNVRCRPTPCLLPNNFSIPHLVITGKE
LTPVGGTVTLSCPTGFYLQGSALAECQVGGSWSPSISSVSCEMVMCEKPPPLLHGIVEGD
SYNYGDFVMYSCLPGFDMKGDSIHICQGDRTWSGTQPVCVASSLQSCGAPPTVQNAQPAG
EPSPDNVTYVCNPGLQLVGPETLTCLDNGTWSLPVPTCEAKTCPAPPGWKEDSSRDRARQ
EFHVGQSVRVTCPKGQQVKGSSTITCRSDQTWSPISSVCERVSCGPPLHVANGVVRGAVF
QFGDVAVYSCYGGYTMEGVGRSRCLENGTWTPPPTCRAVCWLQCQNGGVCQRPNTCSCPE
GWMGRLCEEPICILPCLNGGRCVAPYQCECPTGWTGTRCHTAVCTSACQNGGRCIRPNRC
SCPSGWIGHNCSRKRKPGPYHF
Download sequence
Identical sequences I3K522
ENSONIP00000016217 ENSONIP00000016217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]