SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016445 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016445
Domain Number 1 Region: 219-490
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-83
Family Nuclear receptor ligand-binding domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 166-248
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-31
Family Nuclear receptor 0.00000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016445   Gene: ENSONIG00000013076   Transcript: ENSONIT00000016460
Sequence length 496
Comment pep:novel scaffold:Orenil1.0:GL831141.1:6274909:6375664:-1 gene:ENSONIG00000013076 transcript:ENSONIT00000016460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKPFLSLGFLKPQCSLAPPMQRGRSVDACSCFSGVCPLHDRRLSSDSSGQVTSSPLGS
PTSHRGMHPSLLSPTSMGPSGPLHSPISTLSSPMNGLASPFSVISSPMGPHSMNSPGMGY
GPSVSPQLNSPMNSVSSTEDIKPPLGLNGVMKVPAQPSSTALSLTKHICAICGDRSSGKH
YGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCVIDKRQRNRCQYCRYQKCLAMGMKREAVQ
EERQRAKDKNENEVESTSCANEDMPVEKILEAEEAVEPKTETYIETNLGVPSNSPNDPVT
NICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILL
ATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNP
GEVEALREKVYASLEAYCKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTP
IDTFLMEMLEAPHQMT
Download sequence
Identical sequences I3K5Q0
ENSONIP00000016445 ENSONIP00000016445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]