SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016704 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016704
Domain Number 1 Region: 96-393
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-62
Family Nuclear receptor ligand-binding domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 25-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016704   Gene: ENSONIG00000013281   Transcript: ENSONIT00000016719
Sequence length 397
Comment pep:novel scaffold:Orenil1.0:GL831215.1:323398:330325:1 gene:ENSONIG00000013281 transcript:ENSONIT00000016719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSKPTGSTSGCLDILNVKSSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNR
TYVCKSGSQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR
GHKEVNGSSAHFPGSSLPGPPFFTTVTQLEPHNLEMSTVATTPERQAIVGLAQPTPKYPH
EVSGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVL
GIAQWAIPVDSTTLLAVSGMNTENTESQRMNKIMSEIQALQEVVTRFRQMRLDATEFACL
KCIVTFKAVPTHGSTELRSFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLP
ALRSVSPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences I3K6F9
ENSONIP00000016704 XP_003449910.2.78416 XP_006792547.1.46954 ENSONIP00000016704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]