SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018343 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018343
Domain Number 1 Region: 449-753
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-53
Family Eukaryotic proteases 0.00075
Further Details:      
 
Domain Number 2 Region: 152-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-32
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 3 Region: 308-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000742
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 263-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000891
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018343   Gene: ENSONIG00000014578   Transcript: ENSONIT00000018360
Sequence length 753
Comment pep:novel scaffold:Orenil1.0:GL831142.1:1128538:1150271:1 gene:ENSONIG00000014578 transcript:ENSONIT00000018360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAGRRLQLGKTHGGVRTIPWITTFISGKGHWLLFISVFISISLPQGTAWPYDYRHLYN
HCPGPEWNVMCRGCCEYDVIRCKCPLQGTPVGYAVPCCRNAINECDPCIIHPGCSIFENC
KRCNNGTWGPRDDFFINGKYCAECRPGWSGGDCMKCGGVIHKRQGHLVLESYPNNARCEW
TIQVDRPFTIELRFMMLSLEFHHSCHYDYVEVRDGDSIHSRVIGRYCGNNRPAPVHSSGN
SLHVLFVSDGYKNFDGFFATFQENSACSSSPCLHDGTCILDSSYSYHCACLAGYTGKRCE
NVPVERVCALPPKPANGDHFLVYGPNLYHGYHQVVPGLEPETVEFKCNHSYALSGDVRRT
CQPDGTWSGKQPLCIRACREPKVSELVKQKVLPPQVPSRKTPVHKLYSSVMGQQPQLHSP
TKVPLVLSQLPQGFHQLYTHIEYECASQYYHHFGSPRRTCLKTGKWSGRHVSCSPVCGKH
PTFDTKRPEEAHWPWLAAIYRRSTKGTETKVTKADSQLVCSAALVNQRVLVVAAHCVTDL
GKVFPLDTATIKVVVGKHYRDDDRETKGLQHLRVASIVIHPNYDPNILDSDIAVIKLLDK
ARIGEKVLPLCLSENQEEDLTSTQGLVTGWSPMAESNLGPDEKARVGLVHLADVVPCEQQ
YARNGVPVSVTDNMLCASQKPDYGPSNICPSDTGGILVLPALSENQAQGESKGLWRLLGL
VSFGYDQGECDPDLYTVYTRVASFKDWIESNMK
Download sequence
Identical sequences I3KB48
ENSONIP00000018343 ENSONIP00000018343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]