SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018661 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018661
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000472
Family CUE domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018661   Gene: ENSONIG00000014823   Transcript: ENSONIT00000018678
Sequence length 383
Comment pep:novel scaffold:Orenil1.0:GL831426.1:549499:561083:-1 gene:ENSONIG00000014823 transcript:ENSONIT00000018678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFKRSSSNGGSRSSGNGGGGGSGQGQLNNSRPSRQVRRLEFNQAMEDFKTMFPSMDY
EVIECVLRSNNGAVDATIDQLLQMSIDGQGSDDSSDSDDSIPPEILERTLEPDSSDEEAP
PVYSPPTYDMHIYDRKYLEAPPTPSPRSKPQPPSAHQQVRSYRNWNPPLLGNLPDDFLRI
LPQQLDNIKSSQNSLSQLSSSSSSVSSLSQWTVQSGSGYAAGTTGGPGLITAATEQDKKL
KQYLEDERVALFLQNEEFMRELQRNHEFLIALEKDRLKYESKKSKSNHSTSLENSTGDQY
SGASMEAISDDMFRDKLKHMGKSTRKKLFEIARTFSEKTKRRKSKRRTLLKHHSLGTANS
TANLLDDVEGHHCGKKSCEPYNA
Download sequence
Identical sequences I3KC16
ENSONIP00000018661 ENSONIP00000018661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]