SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019046 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019046
Domain Number 1 Region: 141-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-70
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 72-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019046   Gene: ENSONIG00000015133   Transcript: ENSONIT00000019063
Sequence length 410
Comment pep:known scaffold:Orenil1.0:GL831142.1:5829466:5833885:-1 gene:ENSONIG00000015133 transcript:ENSONIT00000019063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVWRGSQDDVADTQGTLSSQTQGGLSLPTPQAGQVAPPTPQTPVQGPPNNTQSTPTN
QTSQQSEKQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPID
QHHRNQCQYCRLKKCLKVGMRREAVQRGRVPPTQPHHGQFALTNGDPLHCHSYLSGYISL
LLRAEPYPTSRYGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVAL
LRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKA
LHVDSAEYSCLKAIVLFTTDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLL
LRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMPIQ
Download sequence
Identical sequences I3KD51
ENSONIP00000019046 ENSONIP00000019046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]