SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019499 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019499
Domain Number 1 Region: 40-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.83e-54
Family N-terminal domain of cbl (N-cbl) 0.00000187
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 1.33e-47
Family SH2 domain 0.00000406
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 8.94e-43
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 170-255
Classification Level Classification E-value
Superfamily EF-hand 2.18e-36
Family EF-hand modules in multidomain proteins 0.0000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019499   Gene: ENSONIG00000015497   Transcript: ENSONIT00000019516
Sequence length 762
Comment pep:novel scaffold:Orenil1.0:GL831813.1:10479:75212:-1 gene:ENSONIG00000015497 transcript:ENSONIT00000019516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALSSRYPGGRGPNRSKGRILGIIDAIQDAVGPPKQAVADRRTVEKTWKLMDKVVRLC
QNPRLQLKNSPPYILDILPDAYQHLRVILGKYEENQMIIQLSENDYFNIYIDSLMKKSKR
AIRLFKEGRERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPGGQFQGDTFRITKADAAD
FWRRFFGEKTIVPWKVFRQCLHDIHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLHKYINKPGSYIFRLSCTRLGQWAIGYV
TSDGNILQTIPNNKPLFQALIDGYKEGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDIKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRNEGTKCFFLDQQSSPLLDLDDEEDREDCLVMNGLANIRKQCGEHQKSPMVS
PSSSPVSQHKKTHGGNSSQCVQHLSLPPVPPRRDLINKGAIRSPSASPTCSPKSSPGISR
KQDKPLPAPPPPQRDPPPPPPPERPPPVPPESHHSSLPSSSYMSSSSTGMLSEFQISSET
WCSKDSHLTDAHKTGGEHQLQLGPTVPCHLNRRPLSCPSAEFARLHQRLDGAGNSESSKP
FCNGEQVSDEYDIVPSRQLPTQSKLGSSHKSSNPFSSPVLEQHQRAMEGPEGNCHIPSSI
LCLSQTPVCITVASRSLENSPPDLSFEEEKPRSLGPGESFKY
Download sequence
Identical sequences I3KEF4
XP_005466101.3.78416 XP_005466102.3.78416 ENSONIP00000019499 ENSONIP00000019499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]