SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019755 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019755
Domain Number 1 Region: 378-670
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-75
Family Kelch motif 0.0000148
Further Details:      
 
Domain Number 2 Region: 100-219
Classification Level Classification E-value
Superfamily POZ domain 3.35e-30
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019755   Gene: ENSONIG00000015697   Transcript: ENSONIT00000019772
Sequence length 696
Comment pep:novel scaffold:Orenil1.0:GL831347.1:596255:607497:1 gene:ENSONIG00000015697 transcript:ENSONIT00000019772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANGDDSGAGRLSRRLSRLGSRHQSRDQRHLAQQERPPPPPVQQDDRPAPPALVVPPAP
APAPAPAPVFVLPPPMEIPPKRPDKSTKPKLPPRPLSKVFSSTDHGEDVLKGFDSFRGDE
TLCDVVLVPGDSKEKFPVHRVIMASSSDYFKAMFTGGMREQEMREIKLHGVTKLGLKNII
DFIYTSKVSLDMGNLQDTLEAANFLQVMPVLRFCNQLLSSEITIDNCVEVERIATDLLLE
DVQQNIGEFVSQNLSELVECGRYLELSETSMANALSSNSLKGFSELELYHIARGWLDHEP
AKRRTSVYALMRHIRFPLMSPNELIQISQDDEEERDSLMRSETACVNLLLEASNYQMMPY
MQPALQTERTQIRSDATHILVLGGVMRQQLVVSRELRLYDEKTGHWRALKPMEVPRYQHG
VALLGGFLFIVGGQSTYDTKGKTAIDSAYRYDPRFDKWLQIASLNEKRTFFHLSALNGKL
FAVGGRNASGEIDTVECYNLKKNEWTFVNNMVEPHYGHAGTVHEGLMYISGGITRDTFQK
ELWCYDPVADTWSRRADMTELRGLHCMCTVEDRLYVMGGNHFRGCSDYDDVLGCEYYSPD
TDQWTVVSPMPRGQSDVGVTVFNGQIYVVGGYSWNSKCMVDIVQRYDPDKDVWDRVFNVL
EPLGGIRACTMTVHLPEGSVDEAQIQDCPLPTAKSS
Download sequence
Identical sequences I3KF60
ENSONIP00000019755 XP_005475392.1.78416 ENSONIP00000019755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]