SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019820 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019820
Domain Number 1 Region: 371-563
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 98-184
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000923
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 197-276
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000181
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019820   Gene: ENSONIG00000015748   Transcript: ENSONIT00000019837
Sequence length 1136
Comment pep:novel scaffold:Orenil1.0:GL831347.1:1041552:1073267:1 gene:ENSONIG00000015748 transcript:ENSONIT00000019837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIMSPQQGTMGQNRSDSLTGESKALPDSKKKMKTLAQRRQSAPSLVISKALTRSRSTSR
ESCLTPVSPETCPLVQAFLAECPGRLFLGHAQTQLKTGLQTQERHLFLFTDTLLVTKAKS
PTHFKVKAQVRACEMWTANCMEEVCEGSTNPERSFVMGWPTCNCVATFSSEETKDKWLVL
VNSRISEGKEKDDPKTIPLKIFAKDIGNCAYAKTLAVSNTDSTTEVIRMALLQFGISGCI
KDHRLWVSSIKDDPPYPLIGHEFPFSIKMSHIRDGGSNCGGLGGGVGRDVLSPTDCPGVL
LLDQCLPPDTQCQFILKPNKAVLGQTQLLEPGQQKSFKRKRSLINWPFWRGSSTQLDGMP
LSPTLLSAAHGRLFGQPLNSICSPENSLPKPVMDMLAFLYLEGPYTRGVFRRSAGAKACR
ELRDRLDSGSEDAEITHQSVFVIAAVLKDFLRNIPGSMLCVDLYDQWMEAMEGEGGEERI
PAVQRLLHLLPSENLLLLRHVIAVLHCIQGSADDNQMNAFNLSVCIAPSMLWCPAPSTPE
MEGEATKKVCELVRFLIENCSTLLGDVTSLFRTFSQKSSSSDHGSDVSSFQMNDSSYDSL
ENELNDDPESPFQEQLPLRDKDKPDSCSRDSVITLSDGDPEPDPDSNLLLQLPPLARPSR
FSPVVRQPRVRHANGSSQGPRRLRRSSEPALALASMPTSSMVLAHADNCHPSVRKASYDA
AMEGEADVDEVFLEQGLNGLQLKEEGEDGCEKRGVKIQNSGRRKTKHAPPPPLRLDASCS
SLSSPATSPTGSSLSSLDSAFSQYSTDYATNVPLPLSEPLPLSPLFPGRPQQSSRSSPPQ
REALAHWPQATQPPRPGQSASHSHGLHPNTWLKKDRCLTLRQPDSGHTEEDLPVGKSFST
SNCFSVSAQEAMVTNQNCRHRSSSPPSYQQALLQLQRSRSPFYSGTEKPLTVKDLRQLHD
QTSPNKLKPNPGAEVTQRLAEGGCVQPPKGVFFGQSATTLVLQRQKSHSLTPAMDIHRGR
KTLPRRASEPAKVNVNSNRGPSLTLDRLPASKARPQDGRASDNHAKPRLCLSPSATRAVR
DYFSSQGQEDVDACLQRSHEVALAIVQGKKEWQNRRCSDPRLEDFEQLFFAEESYV
Download sequence
Identical sequences I3KFC5
ENSONIP00000019820 XP_005475370.1.78416 ENSONIP00000019820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]