SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019843 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019843
Domain Number 1 Region: 167-261
Classification Level Classification E-value
Superfamily Immunoglobulin 5.02e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 271-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000129
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019843
Domain Number - Region: 55-137
Classification Level Classification E-value
Superfamily TIMP-like 0.00706
Family The laminin-binding domain of agrin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019843   Gene: ENSONIG00000015764   Transcript: ENSONIT00000019860
Sequence length 774
Comment pep:novel scaffold:Orenil1.0:GL831239.1:273388:335397:1 gene:ENSONIG00000015764 transcript:ENSONIT00000019860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEPVHRRLSLPARSAAQQHCSTAQADGMRLDPVHFSMLVIGVSFACYAPSLNSLQDQAYR
SAVVIEGEVRSSPENVSSREPYSVNVKVLDVWPVNSGGLEREQLVTVGDFGSEAPCTTVE
KDHRYIFFMDPTAEPLVFKASYAPVDASEPESKKDVERVLCEDCASAPKLRMISSQSLME
GKKLYLKCEASGNPSPSFRWYKDGHELQKGRDLKIKTNNSRKNSKVQISRVRVEDSGNYT
CVAENSVGQENATSIISVQILTTTTLSPGVSHARHCNDSEKSYCVNGGDCYFIHGINQLS
CKCPNDYTGDRCQNSVMANFYSTKMLLPPKSKVLYFNLREAEELYQRRVLTITGICVALL
VVGIVCVVAYCKTKKQRKKMQSHLHQNQNQCVEQPNRMLANGPNHPGPGPEEIPMVDYIS
KSVPTTECVISHGAEGAGNYAGSRMSTRSHHSTTASHASRHEEHTWSMERTESMNSDCQS
GGLSSSVGTSKCSSPACMARRAAHWGCTDASGPGMQYGDSYDSLRDSPHSDRYVSALTTP
ARLSPVEFHYPPLPPQVPTFQITSPNTSHALSLPPAAAAYHRDDDQPLLRCPDVRKPMPN
PPCDYHSKKSVFSLFQDGSLYRQPRRPRRPYLTESTGSLPSSPYRLPDDEAYETTQEYAS
SREPIRSRRRPRRNRLNGHISQRSAGLRDYSSQSFSQSEEEEEDEEEEDAHGESTPFLSM
QNMNMDPPLNVPGFRSSSGADTRTHRGLSRPGTRSNGQSRGSQSQRSKADNMPL
Download sequence
Identical sequences I3KFE8
ENSONIP00000019843 ENSONIP00000019843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]