SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020588 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020588
Domain Number 1 Region: 767-973
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-50
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 1038-1239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.54e-43
Family BAR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1541-1609
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-17
Family SH3-domain 0.0000801
Further Details:      
 
Domain Number 4 Region: 255-312
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 5 Region: 1304-1385
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000197
Family SH3-domain 0.0000158
Further Details:      
 
Domain Number 6 Region: 149-216
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.001
Further Details:      
 
Domain Number 7 Region: 4-64
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000289
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 8 Region: 69-137
Classification Level Classification E-value
Superfamily SH3-domain 0.000000024
Family SH3-domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020588   Gene: ENSONIG00000016351   Transcript: ENSONIT00000020606
Sequence length 1613
Comment pep:novel scaffold:Orenil1.0:GL831148.1:4567933:4616247:1 gene:ENSONIG00000016351 transcript:ENSONIT00000020606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAVFEFLPSVSEELPLFTGDVIEVLSVVDEFWLLGNKDGVTGQFPSTFVEEVT
IPSTKPGDRLYVCINDFSSAEPGNLSLKRGDVVVGEAGGSVDLGEIWQRGCNVWGARGLF
PTSCVKELTLSCRSRQLSERSAQAQASELPPYALGQARALMSLHAQLSEELDFREGDVII
ITGLPEPGWFQGELDGRRGIFPEGFVELSGPLRSPQEPVDSQYLNKDPQPCIYEETFEAE
EGNEEAGIEQEEEEGGVYGVALYEFRAMEPGELDFDVGDRIRIVGTLEDGWLEGQVRGQR
GIFPHRFVKIEGHVQKIAEETGVVESEEEKEISNTEHTSDHLCPNDPEKEWSMYEDHTVW
DLDYFERAEEHQWACENKSTVAQTVNAGQTDCSQRADSQPRRPAPPAQRGPQRPKSTPPA
RPRLPPRPNFPLHSHRQHAGPASSRNLPTSTNGNHRPLQPKLTHSLTLHNTQPGWSKDSK
YYQRQQRNNASINNRAQALNSVEGQKYKRLTRHASASDADMMSSEIRLRNQQMTRRSNGL
LPTSVTLETLASSTSDLETKLSQQLFEFEKSLSNQPHISRHFSILDYKDERDIIRGSSHS
PVSHLLQSDSHSLERRRTLRPPPPRPRATRPPAPAAYKPTRPAPRPPPQCLRQNRTTPPT
EQELERDGEMELETQTQREEEEEERQQLLLRLQEVERDMEAYAHTAEELRAMLEEEEQDE
TARVQALENLEFCNYTLETLALEQQQLQEMTLLPSEPKTLESAPVSTTPTPSTGSEDPET
RMLEKRSKVIEELLQTERDYIKDLQMCVEEIIEPLQQKQVKNVDYEGLFGNISSVIDLSQ
RLLNSLHETDSIGKVFLDFKVELEEVYKLYCQNHDDAISLLEAYEKDESIQHHVLECLKR
LRAIYLEWGKTNYINLGSFLIKPVQRVMRYPLLLTELLGATPESHHDRAQLTKAVQAVKD
INVNINEYKRRKDLGKAPGVLKYAVSAGLTAQVFPLLSTVVKYRKGDEDTFIDKISKLSM
HSIIKKSNRVSSHLKQLTGISPQIKDEAFDEAEKRFRLQERLIKSFIRDISLYLQHIRES
ASVKVLAAISFCDIYTERSVLDPDRFQRAHRYISDKKFTEFKERTEALVINPLTQLLLMF
AGPHKLIQKRFDKLLDYDNCKERADRFKDRRTQEELQVTRNTYEALNAQLLDELPKFHGV
AEELFTGCVRAFAQAQKDFMKTTLGELKPLLQVFSNKVGTGSNLISQFQEEHSQVLQLLQ
SFSFCPENLPPATAATKKPFEKKTLEKQTSKKQVQGPPSHVPQTDEHRAELLVRFGPEKL
YQADRNFNAAQDLDVSIQEGDLVGVIKQQDPMGSQNRWLIDNGVGTGFVYSSFLKPYNPR
RSHSDVSIESQSSNESGYGGSSPVFSRQNSNSTLTFNQETATVSFTQSQSHSSPQPSLDS
ASSHQTHRNTSSHREVEPSYRHSGSHRDSYDTSYGSSSGHKEVSDLSETDSYSSQRDNRS
QRYGHTDKSYSSYQWRNGDSSNQKKPVYSREEYIEPEPEPEPEQESEVDGHQIYYALYSF
TARCANELSISANERLRILEFKDMNGNSEWWLGEAGGRRGYVPSNYIRKSEYT
Download sequence
Identical sequences I3KHJ3
ENSONIP00000020588 ENSONIP00000020588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]