SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020840 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020840
Domain Number 1 Region: 260-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-80
Family Protein kinases, catalytic subunit 0.000000000185
Further Details:      
 
Domain Number 2 Region: 117-291
Classification Level Classification E-value
Superfamily SH2 domain 2.13e-39
Family SH2 domain 0.0000093
Further Details:      
 
Domain Number 3 Region: 75-126
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000019
Family SH3-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020840   Gene: ENSONIG00000016547   Transcript: ENSONIT00000020859
Sequence length 537
Comment pep:novel scaffold:Orenil1.0:GL831137.1:181415:213216:-1 gene:ENSONIG00000016547 transcript:ENSONIT00000020859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSKSKSKDVGQRTRSLDGNLSSGGGAGGHHLNSTQQSLTPNRSPTMDAGLSGNQSMAN
TAELTLFGGVDNNSVTSSNCITRAGGVTTFVALYDYESRTATDLSFRKGERLQIVNNTEG
DWWLARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLLSLENRRGTFLVRE
SETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVNHYRKHADG
LCHSLTDICPVLKPQTQGLAKDAWEIPRESLRLDIKLGQGCFGEVWMGTWNGTTQVAIKT
LKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMGQGSLLDSLKGEMGK
MLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLDQVE
RGYRMPCPTECPESLHELMLSCWRKEPEERPTFEYLQGFLEDYFTSTEPQYQPGENL
Download sequence
Identical sequences I3KI95
ENSONIP00000020840 ENSONIP00000020840 XP_003438972.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]