SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021863 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021863
Domain Number 1 Region: 54-120
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0048
Further Details:      
 
Domain Number 2 Region: 147-211
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000707
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 3 Region: 243-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021863   Gene: ENSONIG00000017338   Transcript: ENSONIT00000021882
Sequence length 349
Comment pep:novel scaffold:Orenil1.0:GL831367.1:182682:202048:1 gene:ENSONIG00000017338 transcript:ENSONIT00000021882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPELRVSCFCCLLVLLVLPAVRSSFHRSGVDCGPGRAEDCPDLSEKKSDLRVCDTGTCR
FGGTCRENGADIKCVCQFHCNKKYVPVCGSNGDTYQNECFLRRAACKKQRAINIVSEGPC
YHDAGSGSGDGDDEGSGRGKKTSKCGNCKFGAECDEDSEDMICMCNIVCNGHNDNPVCGS
DGVTYDTPCHVREASCLKQLKIDIKHVGRCHDKNRKDDGIKTKPEIYAVPKPGEGEGFED
SPAPCPEDYSQFCEHGICEMRQNLPTCRCEDAYGGQQCEQLLDFNILYVVPSGQKLHYVL
IAAIIGAVQIAVIVAVVMCFTRRCNKTKRGRRQKQHLGHFPSGTSSRMM
Download sequence
Identical sequences I3KL68
ENSONIP00000021863 XP_005461916.1.78416 ENSONIP00000021863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]