SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021921 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021921
Domain Number 1 Region: 209-332
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.15e-59
Family Dystroglycan, domain 2 0.00000186
Further Details:      
 
Domain Number 2 Region: 496-597
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000204
Family Dystroglycan, N-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 91-186
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000722
Family Dystroglycan, N-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021921   Gene: ENSONIG00000017382   Transcript: ENSONIT00000021940
Sequence length 890
Comment pep:novel scaffold:Orenil1.0:GL831137.1:8161708:8165478:1 gene:ENSONIG00000017382 transcript:ENSONIT00000021940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHYKRRDMSCGDAGGSRLISCRTIPLIMGLLVTLTQGTVPEQQETLVEMISVELEASMQS
SVLSELNAAASLVGEGPPTAVPDSSAKNGGVHTSIPDSSATVGQVFQLKVPSGPAHAGCS
VQLTEMGRETLPSWLYWDREGCILRGLALEQDKGVYHIMVSGEEQSQKTSSQVFPSTVFS
IEVYPEERADTEPPLLTLQSDIGGLQPFTCGSEEPVTVLTVILDADLTKMVAEQRVSLLG
NMRKFSHVPLEHMRVVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKVGCALDQGSVP
DISSVQSSAKDGTMSARLGYPVVGWHIVNKKPLGVRRVRRQLYNTPTPVPSLLPPTINQE
PYSRVIPTPTSPSIAPATDNSAPPVRGPLPLPVKPTMRVRDQIAHTPVFGPPQPTRVLGT
TSTIPIQPTMTRPTFVEATAVPTPPSTTKKPKPSSTKRPKKPKTSTPAPREPKSTTPKPP
RRTTALSLAPDSNTVPEIRNPIDQVTAWVGTYFEVKIAADAFYDREDGTTDKLRLTLKKT
PKEPVTETSWIQFNSTIQLLYGLPEEQHEGNHEYFMLATDKGGKSIMDAFEVRVHRWSNN
NKPSVMFAARFHGDPSTLSNDVHKKILLTKKLAYALGDRNSSTVTLRSITRGSIVVEWTN
NSLQQSPCPKDQIAILSSRIADPQGTPKPVFIKAMEPEFKPINISVRGTNKCQQYTFIPP
GEVPMPELPTATPSPDTIKSTDDVYLHTVIPAVVVAALLLIAGIIAMVCYRKKRKGKMTI
EEQATFIKKGVPIIFADELDDSKSPPSSSIPLILQEEKPPLPPPEYPNMSGPHSTLLNQD
LLEEYSVYQDDDPNAPPYQPPPPFTVPIEGKGSRPKNMTAYRSPPPYVPP
Download sequence
Identical sequences I3KLC6
ENSONIP00000021921 ENSONIP00000021921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]