SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021974 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021974
Domain Number 1 Region: 144-393
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.3e-86
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 50-155
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-17
Family Hepsin, N-terminal domain 0.048
Further Details:      
 
Domain Number 3 Region: 17-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021974   Gene: ENSONIG00000017423   Transcript: ENSONIT00000021993
Sequence length 398
Comment pep:novel scaffold:Orenil1.0:GL831334.1:189610:211928:-1 gene:ENSONIG00000017423 transcript:ENSONIT00000021993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILGVAVLLSVGLGLGLSCSGRFQCGSSSQCINNIYLCDGKLHCKNGEDELGCVRLSGRSS
VLQVQIQGKWRTVCSEDWNNRLGRAACKQLGYSSYLESFFISLTYIEKDLQTDLMSFHWN
KSQIIKLHNTPSISKTQCSSGLVTTLKCLECGVRPQYRTRIVGGNISKQGQFPWQVSLHY
RNEHLCGGSIISPYWVITAAHCVYGFVNSSMWAVYVGLTEQPLHGAQALAVEKIVYHNRY
RRKGLGYDIALMKLAKPLEVDGSVQPICLPSHGEEFKEGTLCWISGWGATEEDAGDTSVV
LRSAVVPLISNQNCNRPEVYKGLISSWMICAGYLDGGIDSCQGDSGGPLACEDSSVWKLV
GATSWGIGCAHINKPGVYTRITCALSWIHKQMEVSEKN
Download sequence
Identical sequences I3KLH9
ENSONIP00000021974 ENSONIP00000021974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]