SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022076 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022076
Domain Number 1 Region: 763-1078
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.27e-52
Family Ankyrin repeat 0.0000325
Further Details:      
 
Domain Number 2 Region: 449-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-45
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 228-416,448-529
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.16e-43
Family Ankyrin repeat 0.0004
Further Details:      
 
Domain Number 4 Region: 1079-1162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00093
Further Details:      
 
Domain Number 5 Region: 54-158
Classification Level Classification E-value
Superfamily POZ domain 1.1e-18
Family BTB/POZ domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022076   Gene: ENSONIG00000017506   Transcript: ENSONIT00000022095
Sequence length 1168
Comment pep:novel scaffold:Orenil1.0:GL831410.1:336808:346030:-1 gene:ENSONIG00000017506 transcript:ENSONIT00000022095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CATEEVAKLQKHLALLRQEYVKMQQKLADTERRCAMLAAQSSSQGTPTPAAAETFISRLL
DIVADLYQQEQYSDLKVKVAGEQINAHKFVLAARSDVWSLSNLASTNELDLSDCKPEVAM
AMLRWAYTDELELSEDDAFLIDLMKLANRFQLQLLRERARCEKGVMSSVNVRNCIRFYQT
AEELNASTLMNYCGEIIASHWDDLRKEDFSTMSAQLLYKMIKSKTEYPLHKAIKIEREDV
VFLYLIEMDAQLPGKLNELDNNGDLALDLALSRKLESIATTLVNNKADVDMVDQSGWSLL
HKAIQRGDEFASIFLIRHSAQVNAATVGAVETPLHLVCSFSPKKHSAEVMSGMARITEAL
LKAGANPNMQNSKGRTPLHEAVSSGNEPVFNQLLQCKQLDLELKDHEGSTALWLALQYIT
MSSDPSVNPFEDNAPVVNGTSFDENSFAAQLIQRGSNPDAPDTTTEYCLMQRAALANNEA
AALFLATHGAKVNHVNKWGESSLHTACRCGLASLTAELLQQGANPNLQTQKPLPDDPLGV
AMQTPLHMAIAHNHPDVVSVILEQKANALHATNNFQIIPDFSLKDSMDQTVLGLALWTGM
HTIAAQLLGSGASINDTMSSGQTLLHMAIQRQDSKSALFLLEHQADINVRTQEGQTALQL
AISNQLPLVVDAICTRGADMSVVDDKGDPPLWLALENGLEDIASTLVRHGCDATCWSSGP
SGCQQTLLHRAVDENNEVSACFLIRRKSTVNTPRRPGPNGEGDEEARDGQTPLHLASNWG
LEDVVQCLLEFGANVNAQDSEGRTPIHAAISNQHNVIIQLLISHPDIRLNIRDRQGMTPF
ACAMTHKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRV
QDAAKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLATICSVLLEN
GVDFAAEDENGNNALHLAVMQGRLNNVRVLLTESNIDAEAFNLRGQSPMHVLGHYGKENA
AAIFELFLECMPEYPLDKPDNEGNTVLLLAYMKGNANLCRAIVRAGARLGVTNNQGINIF
NYQVATKQLLFRLLDMLSKEPPWCDGSNCYECGAKFGVTTRKHHCRHCGRLLCHKCSIKE
IPIIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences I3KLT1
ENSONIP00000022076 ENSONIP00000022076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]