SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022090 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022090
Domain Number 1 Region: 395-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-52
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 143-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.33e-17
Family B-box zinc-binding domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022090
Domain Number - Region: 217-298
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0497
Family HBL-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022090   Gene: ENSONIG00000017519   Transcript: ENSONIT00000022109
Sequence length 573
Comment pep:novel scaffold:Orenil1.0:GL831410.1:458235:466818:1 gene:ENSONIG00000017519 transcript:ENSONIT00000022109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADHTSPDYFSCSLCQNLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNLSTSQGSVFAGSNDVPCDFCIGKKLKAVKSCLNCL
ASYCEKHLKPHYESTTFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTVSE
HRGHDIVSAEAERGEKQKLLGVSQAEIKQKCQERVKELEELKTAVDSLKNSAHRAMVESQ
KMFEDMIRSIERMRSEVSKLIGINEKAAFSQSEALIERLEQEIDELKKKESGLKQLYSTE
DHIHFLQNFNYLCTPTDDGFIPRVTVNPDFSFAAVRKAVAEIKERLEEFGREELLRISKS
VNEVPVYTTESRTLDRRSRGKEMTVDNTPPEPKTRADFVKYFCQLKLDHNTAYKELYISE
NSRKVIRTRELQPYGDNSERFDSFAQVLCREALSGGRFYWEIEWNGEFSIGVAYKSISRK
GKGSLCLLGYNDKSWSLLCSDSGYSAWHNRVDKPANGPHSPRIGVYLDHTAGVLAFYSIG
NTMTLLHRFETKFVEPLYPGFGVGTSVRICNVK
Download sequence
Identical sequences I3KLU5
ENSONIP00000022090 XP_003458081.1.78416 ENSONIP00000022090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]