SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022104 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022104
Domain Number 1 Region: 94-293
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-47
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 335-528
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.59e-30
Family BAR domain 0.0068
Further Details:      
 
Domain Number 3 Region: 740-799
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-16
Family SH3-domain 0.00029
Further Details:      
 
Domain Number 4 Region: 589-669
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000112
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022104   Gene: ENSONIG00000017531   Transcript: ENSONIT00000022123
Sequence length 804
Comment pep:novel scaffold:Orenil1.0:GL831246.1:1698450:1709947:-1 gene:ENSONIG00000017531 transcript:ENSONIT00000022123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDPKEGGGSEKEKEKEKVIKRRNRPVFLRYLERRKTDTIVADDTDKGDINLGTLVRRSQ
SDKTEYSAKLKEKMTPRGLSPIPSPAVDPEELRARKMKRRAKVIQELVQTEKDFLTDLEL
CIREVVQPLRNLMIVDVDRLFTNMETVCEVSAALLHRLHEAMADPDPEAVVIGDVFIQAK
AALEDVYKIYCYHHDEANTSLKSYEKDEEIKQHFTTCVLALKKIYDKEGKPNLLDMGSLL
IKPVQRIMKYPLLLGELWHATPEDHPDYQPTQEAFTAAKIINININEFKRRKDIVMKYKR
LEDDGTLRGKLNKFNIHSIRKKGDRFAGYLKILTGADTQVRDEVFDREEKLFRSLEKAVR
QLVKNVQCYLQYTQEMVSVAVQSVQDVKNIVKDSNKNDGNGLVHDNGYDPYKVFRDNLEH
LVLTPLSSLHGMFTAPQKLIQKRYDKLLDYCSHLERSSSFSSASSTTSSSPSPASEDPPG
PAKRDYEALNALLVEELQRFNTAAYTILTNSVVFLVALLRGLMNNALLGAPSVHQLPPPL
SNIAEVQNSIMDELNNLTFVKDNAQKLMERKVSFEKRDRKTAVPEVQHQTEEQRAWLLAE
YPVNRLYQLKRKCNGCQEQDLSLLEGELVALIEDTDPMGSSSRWLVHTGGMQGYVYSTFL
KQYNPLRDSQRAGQMAKEQPQQQPPATVDEDFDDLSLFVSGSGSSSLRSFKLSTTDSCSI
LSGLQGELESAEDTEDTVDSEAQQYYAVYAFQARCEQELTLQEYQHVRILQFCDLGGNKE
WWLAEANGQKGYVPANYLGRMSYA
Download sequence
Identical sequences I3KLV9
XP_005457056.1.78416 ENSONIP00000022104 ENSONIP00000022104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]