SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022485 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022485
Domain Number 1 Region: 510-635
Classification Level Classification E-value
Superfamily TIMP-like 1.04e-24
Family Netrin-like domain (NTR/C345C module) 0.077
Further Details:      
 
Domain Number 2 Region: 340-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 271-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family EGF-type module 0.098
Further Details:      
 
Domain Number 4 Region: 402-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022485
Domain Number - Region: 106-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000284
Family N-terminal domain of xrcc1 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022485   Gene: ENSONIG00000017835   Transcript: ENSONIT00000022505
Sequence length 635
Comment pep:novel scaffold:Orenil1.0:GL831195.1:587184:616766:1 gene:ENSONIG00000017835 transcript:ENSONIT00000022505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGKVSGVFLGWISSLRPAGLSEVVFNGGVAPRCENRACNPRMGNLALGRRVLTQTVCGNN
GSELHCFYSDPDANLACNPAKCAKCNAGLPHLSHLAGAMSDSSFRHPNTWWQSAGGVESE
TVQLDLETEFYFTHLILVFRSPRPAAMTLERSQDFGRTWRMLQYYATNCSAAFRLEEGKA
DVGQDGATCTSKYSGAYPCNRGEVIYRTLPKWESLDPYGLKGQQQLKVTNIRIRLLKHQK
CPCQAKDLASAHEPLPTRHFAIYDLIVKGSCFCNGHADQCVPMPGYQPVRDRTNHVVHGK
CVCRHNTAGVHCESCAPLYNDRPWQPADGLTGAPHECRKCKCNGHAQTCRFDWTAWRESG
QRSGGVCDCLHNTEGRQCEKCKPGFYRDPNRPHAAPDSCKPCNCHPMGSVPFHLADGSLC
DPANGNCICKPGVGGAHCDRCMVGYWGFHEYGCRPCDCAGDCDPFTGDCMFGHDLVPLYY
QISAQFLNSKYKGRVETENMTAHTVLIISQKCECQEQSLTNSKLFCTMNYAYVLKVRVLA
AHDKGSHAEVEVKVQKVLSQTTKMKIQRGRVTLYPESWTARGCTCPILNPGVEYLVAGHL
DRKRGRLLVNMKSFVKPWKASLGRKVLTLLKKDCN
Download sequence
Identical sequences I3KMZ0
ENSONIP00000022485 ENSONIP00000022485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]