SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022748 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022748
Domain Number 1 Region: 2037-2097
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000243
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 480-609,651-728
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000247
Family ABC transporter ATPase domain-like 0.096
Further Details:      
 
Domain Number 3 Region: 828-1055
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000625
Family Extended AAA-ATPase domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022748   Gene: ENSONIG00000018053   Transcript: ENSONIT00000022768
Sequence length 3252
Comment pep:novel scaffold:Orenil1.0:GL831200.1:351992:375201:-1 gene:ENSONIG00000018053 transcript:ENSONIT00000022768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVSPVVHQHRYVPSFFSNDKVQAGVGITADTARKYLHHHFTQNQLHQNPVTLVSPDKLSV
WIVSSERPAVGKSLYIDRLFEKLKQISPRAKHISLKLIEPCVDIDSLIRSLSENLEPLRE
QDPVILHIDTAGVTSQVRSGLEELLFHLLVLGCLNDSHGMLWRRNVAHLITVEVLKTYAF
PPNHQQECLIFFMQTKLGLLDVLPTIRCRPPREVLQLLANRRSLRVKTFDPLMDGQEFYS
EGIQRPYQYLRRYKEKQDLDHFNYQEGSTMGDPSDCLSLFLSYCGMQDPSWGELKNFSWF
LNVQLKDCENSVFCDREFLADQLPGFKGFIVKFMILMARDFASPSLDMSDESPMPLMENS
QEEELLARLTIRKRWENESHPYIFFNADHMSMSFLGFNVQKYWQNTLNAVDPRSNAVLIH
NVMSQELFQGLQRQRISLTEDFDQLPRADKIKRISCVVGAKKGIADKRFDPDPTYELTAD
NVMKMLAIHMRFRCEIPVVIMGETGCGKTRLVRFLCTLQREGRSVENMVLVKVHGGTTAE
MIYRKVKEAEALAHQNRVKHNLDTILFFDEANTTEAIFAIKEILCDRTVRGQPLKADSGL
KVIAACNPYRKHSPEMVERLERAGLGYRVKADETEDRLGKVPLRQLVYRVHPLPPSMASL
VWDFGQLSDSTELSYIQQIVQKKVADHRLPLSCKGIISNVLAASQKYMRSRENECSFVSL
RDVERSMKVLIWFYQHSNVLFSNSTHLSGEEKTLKCLILAVGVCYYPSLVTKEEYLDNIC
GYFPDCYRSSDALQREISSCQDFFLKNIQTRETIAKNVALKENVFLMVVCIELRIPLFLV
GKPGSSKSLAKTVVADAMQGQNSHCELFKNLKQVHMVSFQCSPHSSPEGIIGTFRNCARF
QKDKNMDEYVSVVVLDEIGLAEDSPQMPLKTLHPLLEDGCIDNDKPDPHMKVGFVGISNW
ALDPAKMNRGIFVSRWDPSEDELVETAKGICSSSNPILLKIKHLFPALAKAFLSICKETS
KNQFFGLRDYYSLVKMLFAAVKTTQHEPDDEQVVEAILRNFSGQPEGFDPVIFFQEILQN
LKEIPRPSTLQMVKKNLDHGTTEESRYLLLLTTNNAALHILQQQVFAKGDYPQPEIIFGS
GFPKDQEYAQICRNVNRVKTCMETGRTVILLNMQNLYESLYDALNQYYVYLSKQQYVDLG
LGSHRVKCRVHTNFRLVVVEDQKKVYEHFPVPLINRLEKHRVDRSTDLEPWQHTVLDKLR
VWVKEFSGEASEDFKQSDIFIGFHGDACASALLQALERRALRSARQNEEDKILDLAKDLL
LNCATPDAVVRLKYSDLAKQEIDKLQRLYFQQQHHHSLRDFLEDCLKVYQESSKFLEVTT
FSSLLTKSDVKVVAHALGLHTDRILLLSLHQFDTEVSFCNKIRNCLNTDSDAEILLIQMD
LEESRCSSELIASAKYCTMNYLMSLEDHTCWVIFIVKVSRIPSHSQYIGFQGGVWHSVHI
DDLRDSEDMSLNLSVFCGTLISSLLKPALTGKHCGRVRQGNKNLFSRYLELINHHYIQHC
VLTQSTHRITKDTLKATGSNRAQLNRLSLVRSCIQKAVGLLRDPDGVAPRSMERMHVLLN
LLGAGENHTGAHFQRLLLSRLVEAMAQREEMMCAPKEWVCSEAKKRHALQEGGTLRHTLW
RCLQSTVTPILVSMLEVMDRYANLDLLSDDRTSQGLIQLWLDILGDSQVLHLTPLQKQSE
SDQEVLVQHHFMLDGEEQPCSAPFSWLVSMHLETLWEESEFMPVTKEGGAERILQFVSTF
SNSRLGSHLQKLSDGDRLDYARRYLNDFLLLSLKIKSKEELKVFTKAMLGCVCELQTSTG
TKADLSPAWIMAASKHFAPRLDTLCHIFLLQPQLANHVAQQGSTREPEEMVEDILALGIC
VEETKLLTVASLDECESFMRRVELLQPCLDRAFGQKYSALCGPASLQHLDSIRSLWHGML
VVASFIQHVTYKVKQDDSRLKDLALKHCNLHLNLMQESPDVKSVDTLQQLIRILNSFHEE
SISRDLSRFGISCPVCLSEFEEPSVLPCQHVICLPCLQRCIQAHRRCPKCKEELPSNFNP
TVSPTIKKSLEQQAAIRRCCNAFFLEVVSRFCLSEGQSPEEGVVELLFSLLVFATGHVPL
CAAGDVYKTRELTPFLECVDNSPVVRSVLPKLLLQYSFAQVKSHIHTYLKKLEENLLDIE
DRTELYLLFVNCFQDSLLCSKAREVEKSIEQQTQSDISFLSRIARKKTPDRQEDPAEFLL
NTARLRMCLSTAAELLEKTTAQVKDGEMEANRYLRLVKGVFEYSGNDWLRVYLLRALHRR
SGIERILSLMNSPASRWIFPAEVLRLQQARRMIPTSVDNFLCCGASYRAMRDAVARVLLE
STSDTFVTELKVRKMPGGSQISLLALALFRQVTCRYKSPDVKIHPSKQDTARLEELLGKN
VKSEEFRNFCTSLLSSHIGGPHSCLHISQNLPAQRQTLLELLVHLVSVLLSESPLLVPLR
QIAFQPGNVTNAFLPTMPDDHASEARQWLRGEKKLQSYTCANGHVCFVGECGRPVVTSKC
FCGMPIGGVGHVPVSGFTQHTVQGDQTRTGHVLGEAHQRSDAPERQMTYAQSCILRLLTH
LAMLQGAIKNQREVGKLIHPTPNDVFKFLWQHLEKDMKVLGRTLDQNMDNTAITVHLILA
QFPAVLNVNKGSRNARPDLSSRQRRQQWEKLVCDSAISPVLQDLQNNLAEAQSRIGADDG
LAGSPLMNLLFGDPGKMLSSPSNCPTHRSSFWTLPEIMTVERFSQLVEEKQGQSALPLLS
LFLKRKADAGFLHHLPELAALQSDLLRVFPLASHSTPQTIAQRLQQIPAGYQKKMLSERV
GRFIRVWNSLRAEVANNSDLGVDVNLCEREVTTESSGEFLTPSRHGPGSVLQTLVDFLSE
THNSLVREARRMSGTEDSEYSVPLERISETQLTLCHPERELLPLVLAHCQYTLKKGGETD
SSYDLPIIQTQLARRFLAGKPLIKADTSRYLNRHLQDFSMVLTEVKKKIPQEPLKGSVSS
AMKTVLRSYTDVCDAVFVVEIGLRFLGKTGGEPQGQLLSYLTDSLQMGPQISSTVAKGLG
QSKLEHSIFTWQLLTCWKSELMLNRKQDPFQKLPSEFQKKLSKEQKKDLKAFLAVTDVDT
FSLELHEILLLKTSSAVPDEAYQPHWDIRSTLENHLERNDLPPLPELESLPEEISLGQSA
DVWRAAVEFKRR
Download sequence
Identical sequences I3KNQ3
ENSONIP00000022748 ENSONIP00000022748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]