SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023354 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023354
Domain Number 1 Region: 221-345
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.11e-59
Family Dystroglycan, domain 2 0.00000147
Further Details:      
 
Domain Number 2 Region: 507-609
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000282
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 103-196
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000235
Family Dystroglycan, N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023354   Gene: ENSONIG00000018551   Transcript: ENSONIT00000023375
Sequence length 903
Comment pep:novel scaffold:Orenil1.0:GL831335.1:415317:440459:1 gene:ENSONIG00000018551 transcript:ENSONIT00000023375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDKQSLGWLGPSSGLDVRLPRTRVVLLGVLLAVAVAAELDIDMLGGMVLIEAGGESERF
DGGRGELEASMHSSLLQDFQEVTEGVAAADAGETAANQQNAATPTAFPDTSAMVGCIFQM
KVPNKMEDVYLGDIIKITEMGKDSLPEWLHWDASSRILQGLPLEEDKGVHYITVSISNHT
KSSSSSEVFSIAVHPEDYLDSDSAQLMSNQASTENDIQQFMCGNEEPVTVLTVILDADLT
KMSSEQRVELLDNMRSFSGVGLQYMKMLPVVNNRLFDMSAFMAGPGNAKKVVENGALLSW
KLGCSLDQSTVPDINSVQGPAKEGTMSAKLGYPVVGWHIANKKPHVPKRVRRQLNNTPTP
ILVVPPPTTAVEPPVRIIPTLSSPSIAAPTESSAPPVRGPVPLPGKPTFRVRDPIAHTPT
MGPSQPTRVMESTSSISIQPSMTRPIYVQPTATPATASTPTSTRKTTRKPGKKVKTTTPA
FRTPKAPTTKSPMTTTSRAVPDPFNEKPVLRNPIDQVNALVGTYFEVKIPSDTFFDKEDG
TTDKLRLTLRQNHNEIVPEDSWIQFNTTSQLLYGLPDVQHVGKHEYFMQAADKGDLKAID
AFEVRVNRWPTNDKTPVIFTARFEGEPRSVTNDIHKKILLVKKLACALGDRNSSMVSLRN
ITKGSIVVEWTNTSLPQHPCPKEQIVVMSRTLANSDGRPSQIFRHNMEPEFKPLDVKVKG
RASCRMYSFIPPGDIDIPEPPAVTPGVGSSQDSADDVYLHTVIPAVVVAAILLIAGIIAM
ICYRKKRKGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKPPLPPPEYP
NMATPETTPLNQELLGEYTALQDDDPNAPPYQPPPPFTTPMEGKGSRPKNITPYRSPPPY
VPP
Download sequence
Identical sequences I3KQF9
XP_005469817.1.78416 XP_005469818.1.78416 XP_005469819.1.78416 XP_005469820.1.78416 ENSONIP00000023354 ENSONIP00000023354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]