SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023717 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023717
Domain Number 1 Region: 230-290
Classification Level Classification E-value
Superfamily BPTI-like 1.23e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 2 Region: 361-418
Classification Level Classification E-value
Superfamily BPTI-like 1.38e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 3 Region: 137-230
Classification Level Classification E-value
Superfamily PKD domain 0.000000000628
Family PKD domain 0.0042
Further Details:      
 
Domain Number 4 Region: 309-347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023717   Gene: ENSONIG00000018836   Transcript: ENSONIT00000023738
Sequence length 501
Comment pep:novel scaffold:Orenil1.0:GL831182.1:3803697:3809389:-1 gene:ENSONIG00000018836 transcript:ENSONIT00000023738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYMRSSSSSLLLLLVFALLRPREAVDPYCQDKFRRGNEDFVLYAEDAVKEGAVMLATASF
ASELECERACCGQVHCNLALLEPSVPGEENRTCVLFNCVRRNRFACRFVTQSGYQSYVRD
AVYQKYLAAPQKEGKKHPPVANAGRDVTIQPGETVMLNGTESVALSGAKIKDYRWSLERG
DSSVKIEETNYPDQVQLSNLQTGSYVFKLTVTDSNGKSDDANVTVLVLNPQQTSSYCQAP
VKVGPCRAKFTRWHYNITKGVCETFVFGGCIGNENNFLSGQECLSACRGVTASSQRSVTL
PSAEVCGSPCSPDQLTCDNGCCLDRSMECDNVKQCSDGSDESQCHQLNQTLSLLLDIDVN
KKKAQCTEPPRTGPCRAKLPAWYYDPLDQKCHEFTYGGCDRNENNFLDDQTCSKYCKGIG
ENDVFARGLFERFDKDVDDDSSSITLAVILSVAILSLLAILAYCFLRARKRRTHRPVNTG
PAHEALSEEETSVYNSTTKPM
Download sequence
Identical sequences I3KRH2
ENSONIP00000023717 ENSONIP00000023717 XP_005452560.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]