SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023732 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023732
Domain Number 1 Region: 436-570
Classification Level Classification E-value
Superfamily TIMP-like 2.98e-25
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 211-307
Classification Level Classification E-value
Superfamily Immunoglobulin 5.08e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 389-443
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 4 Region: 325-384
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000795
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 5 Region: 127-179
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000554
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 36-83
Classification Level Classification E-value
Superfamily Elafin-like 0.00000183
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023732   Gene: ENSONIG00000018847   Transcript: ENSONIT00000023753
Sequence length 571
Comment pep:novel scaffold:Orenil1.0:GL831274.1:695327:697157:1 gene:ENSONIG00000018847 transcript:ENSONIT00000023753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSAPNSSKVRWTRAYLLTLLFCDLLEVSLCASVAGTKVEHEGFCPNKLNANLWVDAQSTC
ERECDIDEDCADFEKCCTNVCGFNSCVAARFSDGTPAQPHEQGEGQGDATSASTATCEGF
ICSQQGATCDIWDGQPICKCQDRCEKEPNFTCASDGLTYFNRCYMDAEACIRGVTLTVVP
CRFYLAGPPTSPLPQDTTVHPTPASSQEDPMPPTLYSNPHHQSIYVGGTVNFHCDVIGVP
RPDVTWEKQSDRRERLVMRPDQMYGNVVITNIGQLVIYNAQVWDTGIYTCIARNSAGVLR
ADYPLSVIRRSDDDFSEDPEMPMGRPFSPADCLAEVDLSVCSGERHVDWYYDSKLGSCVT
FSSGGCEDSRNRFETYEECKASCQREDMGICSLPAVQGPCKAWEARWSWNSITKQCQAFV
YGGCHGNANNFHTKKECEANCPQPKRKPCKTCRVKGKMVPSLCRSDFAIVGRLTELVEDL
DSGLARFSLEEVLRDEKMGLTFFNTKHLEVTIAKIDWSCPCPNITVEENPLLVMGMVQDG
MAIIHSDSYVRAINERKLKKLRDALGKKACD
Download sequence
Identical sequences I3KRI7
ENSONIP00000023732 ENSONIP00000023732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]