SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023890 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023890
Domain Number 1 Region: 424-556
Classification Level Classification E-value
Superfamily TIMP-like 2.56e-24
Family Netrin-like domain (NTR/C345C module) 0.032
Further Details:      
 
Domain Number 2 Region: 233-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000187
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 3 Region: 289-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 4 Region: 352-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023890   Gene: ENSONIG00000018975   Transcript: ENSONIT00000023911
Sequence length 558
Comment pep:novel scaffold:Orenil1.0:GL831455.1:423493:434941:1 gene:ENSONIG00000018975 transcript:ENSONIT00000023911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPNDPCYHTDGRPRHCLSEFINAAYGVPVNVNHSLQGNDYDSHITTLTDLNNPHNLTCWM
ADAGTDTGDWVLTLPLGRRFEITYISFQFCHQREPLDPISISILKSMDFGRTWRPMQHYS
GDCLRNFKLPSQTVAQTRHQETEPLCSDPRPLQKQRGGMVLAFSTLDGRPSSPDFDYSPT
LQDWVTATDIRVVFHKVSKNTLAFFDRETKNSETRPPGRAPFALSDLQVGGRCKCNGHAS
RCRRDDTGRAVCVCKHHTAGPDCDVCEDFYFDRPWHRATPTNPNPCVACECNGHSNKCRF
SMEVFQQSGRRSGGVCQKCRHHTAGRHCQYCQNGYTRNHKKPLSHRKACQPCQCHAVGAV
GRWCNQTSGQCLCRRGVTGLRCNRCAPGYEQGKSPLQPCIRIPEVAPTPVYQPQYSIAEE
CVSYCQPSQVKVRMNLETYCRKNYVLKVQVKGMERSGPWWQFSILVQVVFRTGSHSRIRR
GSQSLWVPDRDLGCGCPALQVGRTVLLIGADEGEQPWVPEEKRLVADRSTLALQWQEHWS
PKLRAFRGQDKRGRCPPK
Download sequence
Identical sequences I3KRZ4
ENSONIP00000023890 ENSONIP00000023890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]