SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023973 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023973
Domain Number 1 Region: 349-562
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-44
Family DBL homology domain (DH-domain) 0.00081
Further Details:      
 
Domain Number 2 Region: 717-920
Classification Level Classification E-value
Superfamily PH domain-like 5.47e-29
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 548-668
Classification Level Classification E-value
Superfamily PH domain-like 7.71e-22
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023973   Gene: ENSONIG00000019042   Transcript: ENSONIT00000023994
Sequence length 922
Comment pep:novel scaffold:Orenil1.0:GL831146.1:2293727:2315585:-1 gene:ENSONIG00000019042 transcript:ENSONIT00000023994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSTRHKSYSKPHYLSLYPRSLSMEGQDSSLCVYREGSPRQRGALCSSESFSRRSPLSS
SALSTPTSAVDIPPPFELAYITKRPITKSSPSLLIEGDSSEKNRKKKSSLKRFLMLKFRR
KTENKPAVDVKPSFFKPSAESSHRTPSRLLDLDRSSINSSPQLNSRSVSKLQVSPEPGSP
FLFYKESRRKGNTVAFLNRSVVRVESFEDRSRVPFTPLPLTKPRSISVPNTDTSDYENVP
AISSDYENLQVPQRRPVRQIPLTDFFVRPSRVLSAANETDGYVDMSSLPGFEKKTQSLEQ
ETESAYTEAYNVCVLAAGPQVNPVGEDGRKTMGEEDQLENPPSVEIKPDGRSRAFYIVKE
LVDSERTHVKALKVLQEDFREAVRSTVGDQGEPALDDERLREILNELPDVYTLHRTILAE
LENRIQHWEDSQTIADIFLSRKAEFLVFTTYIGHYDRSMSLLEDSCRTSPAFAEIVQRFE
EKNPAGENASFKHQLLRVIVRVAQYRMLLTDYLNNLSPDSKEYEDTQAAVVIMSDIADQV
NDSLKHGENLLRLVNIEYSVRGQRDLLQPGRIFVKEGTLMKVSRKSRQPRHLFLMNDVLL
YTYPQQDGKYRLKNTLPLTGLKVSKPIIENVQNALKIEATDISITLSASSFFEREDWFYT
LNRAVTEHMRGSVTFSSCSGEARDRLRLTLGEKAPTLVPVSQVMMCMNCTSDFSLTLRRH
HCHGCGRIVCRSCSRNRYPLKYMKDRMAKVCDHCYNELKKRGLSVSGVKQSWKIKMFILP
KTSPRSNRSSRPLSTVFQNIHPPNIWRHRKGTASFAQVTVSEEGSISGSLQRSKKSKRNW
KRLWFLLKDKVLYTYRAQEEKVASESLPLLGFTVRLPDKQRADEEANVFQLYHKNTLYYT
FKAEDNNTAQRWANAMEEATVL
Download sequence
Identical sequences I3KS77
ENSONIP00000023973 ENSONIP00000023973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]