SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024240 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024240
Domain Number 1 Region: 342-606
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-65
Family Nuclear receptor ligand-binding domain 0.00000000961
Further Details:      
 
Domain Number 2 Region: 269-347
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.81e-28
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024240   Gene: ENSONIG00000019260   Transcript: ENSONIT00000024261
Sequence length 608
Comment pep:novel scaffold:Orenil1.0:GL831146.1:4010700:4014173:1 gene:ENSONIG00000019260 transcript:ENSONIT00000024261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMKLEACWGNETDISAMPCVQTQYASLPHDNYFSSEFLNPDLSATLVMDFSGQKDQLSTS
SLPSINTLVGNGYVGEFDAYSCKITTSPPASTVSFSHTGVAESTSSQMHSQAFKLDDLQV
YGCYPGSFALNCLDETLSSCSSDYYGSPVYATASPPTPSFQTESAPVWDSPFSPYPSAPL
PSVADKAAIAQQLSFFTFSSAPEQHSPMGQQHQDAQPSQEDHFFLSPQQHVSSLHCPPVS
LEHRLLESPKTAEGAMMSPKTPNPGSSESRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQ
KNAKYVCLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKIP
VEASSTTPSVNIIASLVRAHLDSSPTIGKLDYSKYRETADSSKEKEDAGDIQQFYDLLTG
SLDVIRKWAQSIPGFMDFCTEDQELLLESAFVELFILRLAYGSDPEKNELIFCNGVVLHR
LQCARSFGDWIDSIVDFSHSLRRLNLDVSLFSCLAALVIITDRHGLKEPKRVEDFQSHLI
TCLREHVSGNGSELSRTQPNYQSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVEK
IFMDTLPF
Download sequence
Identical sequences I3KSZ4
ENSONIP00000024240 ENSONIP00000024240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]