SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024691 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024691
Domain Number 1 Region: 126-272
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-19
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 2 Region: 258-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000393
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 3 Region: 44-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000089
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000024691
Domain Number - Region: 302-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00635
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024691   Gene: ENSONIG00000019612   Transcript: ENSONIT00000024712
Sequence length 462
Comment pep:novel scaffold:Orenil1.0:GL831171.1:4388233:4399149:1 gene:ENSONIG00000019612 transcript:ENSONIT00000024712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLERRGFRFCSPSRMLTALVFILLCVQPGRGQTCTEGFAYERRTRQCIDVDECRTMPDA
CRGDMRCVNQNGGYLCIPRNLYNQPYRPDPIVPEPVYPDPSAGDSFVQSPPRSVEPSYPR
VISTAQCILGYALAEDGTCNADIDECETNSHHCNPTQVCINTAGGYTCSCTEGYWLIGGQ
CQDIDECRYGYCQQLCANVPGSYSCSCNPGFILNPDSRTCQDVDECADEPCSHGCLNTYG
SYMCNCDEGFELASDGTTCIDLDECSFSEFLCQYRCVNIPGSYSCICPPGYYIYEDGRSC
EDINECDTGNNTCTTAQVCFNFQGSYTCLNTLQCNPPYVEVSDNQCMCSAENPACRDKPF
TILYRHMDMSSGRSVPADIFQMQATTRYPGAFYIFQIKSGNDGREFYMRQTSNVSATLVL
SRPIKGPKKVVLDLEMVTVNNVINFRGSSIIRLTIFVSEHPF
Download sequence
Identical sequences I3KU95
ENSONIP00000024691 ENSONIP00000024691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]