SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024819 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024819
Domain Number 1 Region: 282-373
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.7e-37
Family Small-conductance potassium channel 0.0000148
Further Details:      
 
Domain Number 2 Region: 150-323
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-26
Family Voltage-gated potassium channels 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024819   Gene: ENSONIG00000019717   Transcript: ENSONIT00000024840
Sequence length 423
Comment pep:novel scaffold:Orenil1.0:GL831250.1:1257389:1264327:-1 gene:ENSONIG00000019717 transcript:ENSONIT00000024840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRSHNIGWRLVRRRALFLRRQRLNDCALAVGIFGVVVMVMETELSWSVYSKSSIYSLALK
SVISFSTLILIGLIIAYHWCEVQLYVHDIGAEDWRIAMTTDRLALIVLELAAVAIHPYPV
GLQAYFQQVKTRMSLSETELEIVLALPMFLRLYLLGRAMMLHSRLFTDTASRSIGALNKI
HFNTRFVGKTLMTTYPGTVLMIFSVSLWIVAAWGLHVCESRHHNYRDLSSNYMEALWMVS
VTFLSIGYGDVVPHTYCGRSICLLTGIMGAGCTVLVVAVVARKLELTRAEKHVHNFMMDS
HISKRIKIAAANVLRETWLIYKHTKLLRERDHSRVRMHQRKLLLAIHQLRQVKMEKRILA
DQGNTLVDLNKMQNLMYDVLSEVQGCRGDLDTHIHTLEKSVEELREGFRSLMPLLSSTLS
TQN
Download sequence
Identical sequences I3KUM3
ENSONIP00000024819 ENSONIP00000024819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]