SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025121 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025121
Domain Number 1 Region: 22-300
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-60
Family FCH domain 0.0075
Further Details:      
 
Domain Number 2 Region: 325-385
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-19
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025121   Gene: ENSONIG00000019946   Transcript: ENSONIT00000025142
Sequence length 387
Comment pep:novel scaffold:Orenil1.0:GL831136.1:7908979:7917731:1 gene:ENSONIG00000019946 transcript:ENSONIT00000025142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLPKEPAEDARKQSFWMPGNYVRTVHRTERSFQACNDIVACFMERAKVEKQYAQQLSQ
WSSKWKSIVDSRPLYGSLMRAWQCFFTSTERLSALHSSISQSLTSEEGVRVKTWQKETFP
KKIFCGFRESYDTNTSFSRAQKPWSKKLMKLEKVRVAYHKACQREQAALEKEKQANENSE
MSQEKKQKMTEAREKATEEKEMARDKYEKILEDVSTYTPRYMEEMEAIFEQSQEEERKRI
SFLKQVFLSIHRHLDVTNNESVKAVYSELHQTLMAIDEQDDLKWWKNNHGPGMPTDWPKI
EEWVPPVKKLKRKKRDQKGKESRPVMIGGVKVRALYDYVGEEGDELSFKAGEVFLKVEEE
DDQGWCRGVLSGGKEGFYPANYAEVAE
Download sequence
Identical sequences I3KVH5
XP_013129526.1.78416 XP_013129528.1.78416 ENSONIP00000025121 ENSONIP00000025121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]