SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025192 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025192
Domain Number 1 Region: 176-451
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-82
Family Nuclear receptor ligand-binding domain 0.00000000247
Further Details:      
 
Domain Number 2 Region: 124-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-29
Family Nuclear receptor 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025192   Gene: ENSONIG00000020007   Transcript: ENSONIT00000025213
Sequence length 457
Comment pep:novel scaffold:Orenil1.0:GL831408.1:481721:500096:1 gene:ENSONIG00000020007 transcript:ENSONIT00000025213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSRDSHSPDSSSVSSPPSGQRSPPLVPSAASMTSLPPITSAGVNSPISSIGSPFSVIS
SSLGSPCLPGTPSVGYGPISSPQINSTVSMSGLHAVSSSDDVKPPLGLKQLSSHSPGPML
SQKRLCSICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCTVDKRQRNRCQY
CRYQKCLAMGMKREVAKMNDRSVQEERQRNKDRDGEVESTSAVNEEMPVEKILEAEMAVE
QKTELHADGSSGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGW
NELLIASFSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKT
ELGCLRAIILFNPDAKGLSNPSEVELLRERVYASLEAYCKQKYPDQQGRFAKLLLRLPAL
RSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLT
Download sequence
Identical sequences I3KVP6
ENSONIP00000025192 XP_013121402.1.78416 ENSONIP00000025192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]