SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025618 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025618
Domain Number 1 Region: 474-597
Classification Level Classification E-value
Superfamily TIMP-like 3.66e-23
Family Tissue inhibitor of metalloproteinases, TIMP 0.021
Further Details:      
 
Domain Number 2 Region: 231-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 3 Region: 299-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 4 Region: 362-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000025618
Domain Number - Region: 53-129
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00068
Family APC10-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025618   Gene: ENSONIG00000020329   Transcript: ENSONIT00000025639
Sequence length 598
Comment pep:novel scaffold:Orenil1.0:GL831152.1:4065726:4069622:1 gene:ENSONIG00000020329 transcript:ENSONIT00000025639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASVSSCLDRACSPPIGNLASGRTLFTLSNCCGNGTSQHPLCPQPSVSPQACSQDPHPVLH
MTDDPFLHPDTWWASGGGRTMQEQQDEIRLDLETKFYLTHLVLVFKSPRPAAMAIERSVD
FGKTWEAVKVFAYNCSVEFGLPDDFDQPGSPCTSRYTDAAPCTGGEVILRTLNPSSAMTL
DPYSPEALSRLTITNLRVRLLKSQTCRPTLTSENSASAPYAIYTLLARGTCLCHGHAEYC
VPHNNGNKEIEDSNMVFGRCLCTHHTAGDHCDKCAPLYNDRPWRPANGSSGEANPCQKCE
CHGHAATCHFSQRAWLSSGRLSGGVCEDCQHNTAGRRCHRCRYGYHRRPSLPLSSPHTCT
RCWCDPQGSFPSPPGKEGPWCHPRSGQCHCKSGVGGTSCSHCLPGYWGFGGEGCKPCTCP
HQCDPFTGQCLHRKIPDLDHLLPTEEEAHLSQELTVSALHYTDIQSITLFLYTGKCSCKE
KKLRSVSELCKTKPDYVIKANVLSAHDKGSHAEVHVKVRKVLRSGQVALRLGTANIYPLS
WTSRGCTCPILNPGMEYLLAGKEEPGTGRLLVTMQSIVVPWTPRVGLIISNSLRNGCR
Download sequence
Identical sequences I3KWX2
ENSONIP00000025618 ENSONIP00000025618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]