SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025638 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025638
Domain Number 1 Region: 709-920
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.14e-40
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 1074-1268
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-30
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 908-1025
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-23
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025638   Gene: ENSONIG00000020344   Transcript: ENSONIT00000025659
Sequence length 1270
Comment pep:novel scaffold:Orenil1.0:GL831152.1:4396054:4430905:-1 gene:ENSONIG00000020344 transcript:ENSONIT00000025659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTVTEEYPYDVIGPTDDASDTCESCDPAETGDTEVWQPERATKDPSGCFRFTSSTEDV
FGPYSVIQAVPGDVTDTADPEWNQDDTDGKPSTTDEEHTTGYASNQEPYYVSSDDVDKLE
DKQALSELGHIDEATEQSNEHKDKAKDSESADEYANIDDSLCPKDDDLEQLECVSSEDYI
EIGDDDEEEAEEKKHFRVKSAKERNAKREQALRSQRKSCQPRLRLCNITVPADLDLGRTP
ELTNRVVFAHTTEAFEEDIEELDCHIVPYYEDTDSDSEEHIYEEAGFDSEGENFVTLDRK
TIVTRSRSYSGKVPGYVPETVPEETGTEYQTHDYYSVSLDKNSESTSHPQQAGVNCVIPS
MKSRRFLLYSRSADGPNMSLSSPIEMSQSLKDEIRMKRKDDTLSLPCMITSSGSFSQRSH
QSSSGISTPTSLVDIPPPFELAYITKRPVTKSSPSLLIQHEPSDLPKKKKSSFKRFLALK
FKKKTDSKGFSDGSVRSSRSSSESSHHGPVRVIELDRRSTGSSPQSQSRIVKPQQRPSDL
PSTFLLYKDQHRRKGDPKAYGRSVSRVESFEERSRRSAMPLPLTKPRSISFPSADTSDYE
NIPAMSSDYENIQIPGRPTRSHTVTEFFEDPNRSTVPCNENDGYVDMNSFPGIDSKPQPS
KSDSESAYTEPFPIPVSAGLSADEDHGRTSEEEEGAVEQGYERQIDGRSRAFYIAKELVD
SERLHISALKHLQEDFRSAVTEAVDEEGDPVLEEQRLGEILGVLPEMYTLHSSIFTELEE
RISQWEESPKVADVILSRRDNFSAFDTYISEYDRSMSLLEESCRKNPAFAKIVKTFETRS
PEEAEVPLKHQLLQVIVRVLQYRMLLTDYLNNLSPDSKEYEDTQAALVIVSEVADQANDN
LKQGENLLRLVHIEYSVKGKRDLLKPGRMFVKEGTLMKVSRKSRQPRHLFLMNDIMLYTY
PQQDGKYRLKNTLSLSGMKVSKPTLGDVLNCLKIEVSDITITLSASSVGEREDWFHTLSR
AIADHAAGLCTFGGPCSEAREKLWMALGEAAPVLVPVSHVMMCMNCTSDFSLTLRRHHCN
ACGKVVCRACSRNRYPLKYLKDRLAKVCDHCYAELRKRGGSVSAACDNSSPRTHRASRPL
SAVFQSLQPPSLWKSRKSISPLTQVSLGVEGSTMSGSLQRRKKSKRKWKRLWFLLKDKVL
YTFTASEDKVASESLPLQGFTVKLTERPEGEESSNVFHLYHKKTLYYSFKADDQNTARRW
VNAMEEATIL
Download sequence
Identical sequences I3KWZ2
ENSONIP00000025638 ENSONIP00000025638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]