SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000267 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000267
Domain Number 1 Region: 92-223
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-26
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily Sec7 domain 0.00000000000000157
Family Sec7 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000267   Gene: ENSONIG00000000208   Transcript: ENSONIT00000000266
Sequence length 362
Comment pep:known_by_projection scaffold:Orenil1.0:GL831315.1:455503:460319:-1 gene:ENSONIG00000000208 transcript:ENSONIT00000000266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNTDLHGQHVGKSMSSSKFVSNLDGMNDGVNFSKDLLKSLYNSIKNEPLEWAVDEDEL
KKVVNEDPGDSPRLRSKDNPFLDVPHDKKAAVVKNGFLQRKLHADIDGKRTPWGKRSWKT
FDGELKGMVLYLQKNDYRRDQHINEEVVSVHHSLAEPAANYTKKPHVFRLQTADWRVFLF
QASSKAEMNSWISRINLISALHSAPPFPAAVGSQRKFRRPILPASQSAETLEHQLQSHAK
MLESFKMDLTNQQQSTLDSKKAKARDMEEYRVKAEYLQHEICRYETYIRMLEGWKSVKKT
GNAVCADSLGEEDDEEGMLKKSHSSPSLELEVAPATVVKVRRNISERRTYRKPIIPRWNK
EV
Download sequence
Identical sequences I3IUH7
ENSONIP00000000267 ENSONIP00000000267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]