SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000458 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000458
Domain Number 1 Region: 166-273
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.96e-32
Family Elongation factor TFIIS domain 2 0.003
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 8.89e-21
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00026
Further Details:      
 
Domain Number 3 Region: 295-340
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 9.78e-17
Family Transcriptional factor domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000458   Gene: ENSONIG00000000365   Transcript: ENSONIT00000000457
Sequence length 342
Comment pep:known_by_projection scaffold:Orenil1.0:GL831618.1:119055:125496:1 gene:ENSONIG00000000365 transcript:ENSONIT00000000457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKDQEVERIARKLDKMVQKKSMDSALDLLRELKNIKMSLETLQVSNSTKTVNAVRKQSS
NEEVQTLAKTLIKSWKKLLVASSSVRNRNPECTNNGSEEKKKDSSPVRSSSTSKDYGSSE
KGLTASLSEASACLHVCDQEKVSLDSKSSEGPPSTPTSPTTTTLSQVTSFPPAPVTTDCV
RSKCRELLVVALQTDDDHKAIRVDCEHLAAQIEEHIIFQEFKSTDMKYKTRLRSRISNLK
DQKNPELRRNVLCGNISPHRIACMTAEEMASAELKQMREALTKESIREHQLSKVGGTETD
MFICSKCHGKSCTYTQVQTRSADEPMTTFVLCNDCGNRWKFC
Download sequence
Identical sequences I3IV18
ENSONIP00000000458 ENSONIP00000000458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]