SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000616 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000616
Domain Number 1 Region: 10-80
Classification Level Classification E-value
Superfamily ARM repeat 0.000000672
Family Armadillo repeat 0.037
Further Details:      
 
Domain Number 2 Region: 127-185
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000302
Family HMA, heavy metal-associated domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000616   Gene: ENSONIG00000000484   Transcript: ENSONIT00000000615
Sequence length 265
Comment pep:known_by_projection scaffold:Orenil1.0:GL831143.1:451728:457232:1 gene:ENSONIG00000000484 transcript:ENSONIT00000000615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDALSVVSQLRDLASEPQNREVIVQDQGCLPGLVLFLDHQNPDVLFATLQTLRYLAELS
ANIPTMKNELGMMVSLENLMARDGLSVDITSLAKEVYDILNAPANPPPERKKKPQFFLNS
SNKKAKSITLHIQGLDSSHRGLCEEALLKVKGVISFTFQMASKRCTVRIRSDLPTESLAT
AIADTKVLSAQQVIKNEAGEEVYIPLKSSGVDVPQNSALPDYLPEEEESPVREVDRAISR
TTAKEDSSGSWLNAAASFLTKTFYW
Download sequence
Identical sequences I3IVH6
XP_013124283.1.78416 ENSONIP00000000616 ENSONIP00000000616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]