SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000727 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000727
Domain Number 1 Region: 175-209,238-464
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-73
Family Nuclear receptor ligand-binding domain 0.0000000099
Further Details:      
 
Domain Number 2 Region: 126-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.22e-25
Family Nuclear receptor 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000727   Gene: ENSONIG00000000573   Transcript: ENSONIT00000000726
Sequence length 465
Comment pep:known_by_projection scaffold:Orenil1.0:GL831143.1:1033109:1055297:1 gene:ENSONIG00000000573 transcript:ENSONIT00000000726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVDLYLPECFTYHSDTEHLDRMSVRGLDPTCPSSIKREPSSPSPSSQGDVSPAQPSPG
SSSSDTNSSYGPLTKGHNHNNGQDSPGLFSHTAGLASNGGANRLVRFGEEEGQVKCEFML
GSVAKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRKSC
QACRFVKCLAVGMLREGVRLDRVRGGRQKYKRRIDAENSPYLHPQNALPQKKTFSVGGVV
ENKVVSLLLVAEPEGIFAMPDPTVPESDIKALTTLCDLADRELVVNIGWAKHIPGFPSLS
LADQMSLLQSGWMEILILRVVFRSLALEDKLVYAEDYIMDEEQSKLAGLLDLNNAILQLV
KKYKAMGLEKEEFVVLKAIALANSDSMHIEDSEAVQRLQDVLHGALQDYETIHHPEDPRR
AGKMIMTLPLLRQTAARAIQHFCSIKQDGRVPMHKLFLELLEAKA
Download sequence
Identical sequences I3IVT7
XP_005449658.1.78416 ENSONIP00000000727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]