SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001436 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001436
Domain Number 1 Region: 68-348
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-59
Family Nuclear receptor ligand-binding domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 19-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.02e-26
Family Nuclear receptor 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001436   Gene: ENSONIG00000001134   Transcript: ENSONIT00000001435
Sequence length 349
Comment pep:known_by_projection scaffold:Orenil1.0:GL831203.1:617239:621517:-1 gene:ENSONIG00000001134 transcript:ENSONIT00000001435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSILRGDYMTSMGAVGPKRLCLVCGDFASGYHYGVASCEACKAFFKRTIQGNIEYSCPVM
NECEITKRRRKACQACRFQKCLQAGMMREGVRLDRVRGGRQKYKRRVDTGLSLCTKAPYS
HPSSSRNKVISHLLLTEPAPLAANQDNSTNDSSLRILLTLCDLLNRELLVLIGWAKQIPG
FSGLLLVDQMSLLQSGWMEALLVGVAWRSQGAGGDELVFAGNLRLDEAQCRATGLADLYE
ALRHLMAKYRAMKLSPEEVVTLKAMALANSDADPVDCPDSVQRFQDGLHEALQDYESSRR
EQRRAGRLLMTLPLLRQTADRAVQAFLRLHRHHRVPIHKLLLEMLDAKA
Download sequence
Identical sequences I3IXU6
ENSONIP00000001436 ENSONIP00000001436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]