SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001479 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000001479
Domain Number - Region: 530-584
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000131
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001479   Gene: ENSONIG00000001171   Transcript: ENSONIT00000001478
Sequence length 712
Comment pep:known_by_projection scaffold:Orenil1.0:GL831203.1:710940:732994:1 gene:ENSONIG00000001171 transcript:ENSONIT00000001478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEEDDLMSGNRSDDGGGTPVQDEHPASDGEEMRSAGRRSEDEGSNDEDDAMVTGGGAS
GSDNEDCRRADSDSEGEGPGDRDDKSDSEAEAPRPADSDNEDGSSSVKRRMSASEEEEES
PEKRRTSGSDNEASSPLKRGASDNEEGASPPPKRRGSSSDVEERPKAAAESDSDNEDAKA
TASPERRSNADSDSDTETPARRKAAQIDSDEEEKQEEEGGGEKWKGVMQSDSEEEEEGGR
RKAAAGSDGEQQEEEKRQQRGDSDEDDEKPVKRKKAILSDSEDEDEEKAEKPVAKRSRAV
SDDENSDSDADFGGPDKSLAAKLKELGSDSESEEDDRAKAAGNKDEKALFGSDSDSGEDQ
EEKMIADIFGESGDEEEEEFTGFNQEDLEGDGKAKQKVQAEEEESDSDEGIDRSGQDTSM
MSDFDIMLARRKAMNSKKRRHRDGGTFISDADDVVNAMITKMNEAAEEDRALNSQKKPAL
KKLMLLPQVVMHLKKQDLKETFIDSGVMSAIKEWISPLPDKSLPALRIREELLRILQELP
SVSQETLKHSGIGRAVMFLYKHPKESRANKDLALKLINEWSRPIFGLTSNYKGMTREERQ
QRDLDQQMPQRRRLSSGGQTPRRDLEKQLTGEEKALRPGDPGFCARARVPMPSNKDYVVR
PKWNVEVDSSRGPVRKSLSRVDKQMRRFADIRRLTKTGHAVKISVEGNRMPL
Download sequence
Identical sequences I3IXY9
ENSONIP00000001479 XP_005474948.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]