SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001480 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000001480
Domain Number - Region: 574-628
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000144
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001480   Gene: ENSONIG00000001171   Transcript: ENSONIT00000001479
Sequence length 762
Comment pep:known_by_projection scaffold:Orenil1.0:GL831203.1:714134:730939:1 gene:ENSONIG00000001171 transcript:ENSONIT00000001479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEHPASDGEEMRSAGRRSEDNEDGAARQEEKKRSSEKIDGCSEGVQAQGCQDEGSNDEDD
AMVTGGGASGSDNEDCRRADSDSEGEGPGDRDDKSDSEAEAPRPADSDNEDGSSSVKRRM
SASEEEEESPEKRRTSGSDNEASSPLKRGASDNEEGASPPPKRRGSSSDVEERPKAAAES
DSDNEDAKATASPERRSNADSDSDTETPARRKAAQIDSDEEEKQEEEGGGEKWKGVMQSD
SEEEEEGGRRKAAAGSDGEQQEEEKRQQRGDSDEDDEKPGKNKKTSPWRAARCLLCSWSD
GRSWAAESPDTFAGSVNISVKRKKAILSDSEDEDEEKAEKPVAKRSRAVSDDENSDSDAD
FGGPDKSLAAKLKELGSDSESEEDDRAKAAGNKDEKALFGSDSDSGEDQEEKMIADIFGE
SGDEEEEEFTGFNQEDLEGDGKAKQKVQAEEEESDSDEGIDRSGQEDFDIMLARRKAMNS
KKRRHRDGGTFISDADDVVNAMITKMNEAAEEDRALNSQKKPALKKLMLLPQVVMHLKKQ
DLKETFIDSGVMSAIKEWISPLPDKSLPALRIREELLRILQELPSVSQETLKHSGIGRAV
MFLYKHPKESRANKDLALKLINEWSRPIFGLTSNYKGMTREERQQRDLDQQMPQRRRLSS
SGGQTPRRDLEKQLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEVDSSRSVCF
QGPVRKSLSRVDKQMRRFADIRRLTKTGHAVKISVEGNRMPL
Download sequence
Identical sequences I3IXZ0
ENSONIP00000001480 ENSONIP00000001480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]