SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002112 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002112
Domain Number 1 Region: 121-132,259-306,335-539
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-64
Family Nuclear receptor ligand-binding domain 0.000000326
Further Details:      
 
Domain Number 2 Region: 50-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.01e-28
Family Nuclear receptor 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002112   Gene: ENSONIG00000001686   Transcript: ENSONIT00000002112
Sequence length 543
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:5323359:5327510:1 gene:ENSONIG00000001686 transcript:ENSONIT00000002112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPGYHLQQDQPLVHHPGNYPEDLINLEGSSTSQEQKTEAESRPDSEDSCPVCGDKVSG
YHYGLLTCESCKGFFKRSVQNNKHYTCAEQQRCPMNLSQRKRCPFCRFQKCLAVGMKKEA
VRADRMRGGRNKFGPLYRRDRQMKQQKVYHQSNTDPYRIKVETGQIHGPQALNDLQVVTS
CISHPSPSEAVNQPHMYPSCMGQSSEPMSLDCTVNTDRGLTPPSLPYPGLYHCTFPGHPE
EKLEVPFGYSPVPVNYTVHSTPNSSFTPRSTLESSPCSTKSLTTPVSQAPTQTPTNPLSS
ALTPNFLSQLLEGEQDESQLNAKVLASLQREQANRGKHDRLNTFSIMCKMADQTLFCLVE
WARNSSLFKELKVEDQMVLLQSCWSELLVLDHLCRQVTYGKEGCIYLVTGQQIEVSTIIS
QAGVTLSSLVSRTQDLVSKLKALHLDRHEFVCLKYLVLFNPDVKSVHNRRQVEQTQERVN
RALMEYTQRNHPGHCDKFGQLLLRLPEVRSISLQIEDYLYQRHLQGDLPCNSLLTEMLHT
KHS
Download sequence
Identical sequences I3IZS2
XP_003442265.1.78416 ENSONIP00000002112 ENSONIP00000002112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]